HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Characterization of plasma triiodophenol binding proteins in vertebrates and tissue distribution of triiodophenol in Rana catesbeiana tadpoles. Characterization of plasma triiodophenol binding proteins in vertebrates and tissue distribution of triiodophenol in Rana catesbeiana tadpoles. Comp. Biochem. Physiol. C Toxicol. Pharmacol. (1532-0456) 2011 imex curation Yamauchi K., Sai G. sbkyama@ipc.shizuoka.ac.jp 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro competition binding competition binding weight by staining molecular weight estimation by staining weight by staining Yamauchi K., Sai G. sbkyama@ipc.shizuoka.ac.jp Accepted 2013-MAY-29 by ORCHARD 17-Jun-2013: Contacted by IntAct-Help. Comp. Biochem. Physiol. C Toxicol. Pharmacol. (1532-0456) 2011 imex curation tthy_rat Transthyretin Ttr Tt Prealbumin TBPA protein protein rat Rattus norvegicus (Rat) Rat MASLRLFLLCLAGLIFASEAGPGGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTADGSWEPFASGKTAESGELHGLTTDEKFTEGVYRVELDTKSYWKALGISPFHEYAEVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN 67F00D09BCF195BA tthy_chick Transthyretin TTR Prealbumin TBPA protein protein chick Gallus gallus (Chicken) Chicken MAFHSTLLVFLAGLVFLSEAAPLVSHGSVDSKCPLMVKVLDAVRGSPAANVAVKVFKKAADGTWQDFATGKTTEFGEIHELTTEEQFVEGVYRVEFDTSSYWKGLGLSPFHEYADVVFTANDSGHRHYTIAALLSPFSYSTTAVVSDPQE 1F82A776A9996360 chebi:230446 2,4,6-triiodophenol small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) tthy_pig Transthyretin TTR Prealbumin protein protein pig Sus scrofa (Pig) Pig MASYRLLLLCLAGLVFVSEAGPAGAGESKCPLMVKVLDAVRGSPAVNVGVKVFKKAADGTWEPFALGKTSEFGELHGLTTDEKFVEGIYKVELDTKSYWKALGISPFHEYAEVVFTANDSGRRHYTIAALLSPYSYSTTALVSSPKEGAL 0427FD5D3094CA07 chebi_230446-ttr-3 1 I125-TIP 4 unspecified role unspecified role neutral component neutral component i125-tip 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined TTR 3 unspecified role unspecified role neutral component neutral component chick-serum Chick serum serum Serum physical association physical association 3 chebi_2304-chebi_230-1 1 TIP 4 competitor competitor competitor neutral component neutral component TIP 4 unspecified role unspecified role neutral component neutral component i125-tip 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined TTR 3 unspecified role unspecified role neutral component neutral component chick-serum Chick serum serum Serum physical association physical association 3 chebi_230-chebi_23-2 1 TIP 4 competitor competitor competitor neutral component neutral component TIP 4 unspecified role unspecified role neutral component neutral component i125-tip 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined TTR 5 unspecified role unspecified role neutral component neutral component pig-serum Pig serum serum Serum physical association physical association 3 chebi_230446-ttr-1 1 I125-TIP 4 unspecified role unspecified role neutral component neutral component i125-tip 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined TTR 5 unspecified role unspecified role neutral component neutral component pig-serum Pig serum serum Serum physical association physical association 3 chebi_230-chebi_23-1 1 TIP 4 unspecified role unspecified role neutral component neutral component i125-tip 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined TIP 4 competitor competitor competitor neutral component neutral component TTR 2 unspecified role unspecified role neutral component neutral component rat-serum Rat serum serum Serum physical association physical association 3 chebi_230446-ttr-2 1 I125-TIP 4 unspecified role unspecified role neutral component neutral component i125-tip 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined TTR 2 unspecified role unspecified role neutral component neutral component rat-serum Rat serum serum Serum physical association physical association 3