UniProt UniProt http://www.uniprot.org Myotubularin controls desmin intermediate filament architecture and mitochondrial dynamics in human and mouse skeletal muscle. Myotubularin controls desmin intermediate filament architecture and mitochondrial dynamics in human and mouse skeletal muscle. J. Clin. Invest. (0021-9738) 2011 mimix curation Hnia K., Tronchère H., Tomczak K.K., Amoasii L., Schultz P., Beggs A.H., Payrastre B., Mandel J.L., Laporte J. mtm@igbmc.fr 02-Aug-2013: Contacted by IntAct-Help. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hnia K., Tronchère H., Tomczak K.K., Amoasii L., Schultz P., Beggs A.H., Payrastre B., Mandel J.L., Laporte J. mtm@igbmc.fr Accepted 2013-JUN-25 by MGT 02-Aug-2013: Contacted by IntAct-Help. J. Clin. Invest. (0021-9738) 2011 mimix curation Myotubularin controls desmin intermediate filament architecture and mitochondrial dynamics in human and mouse skeletal muscle. Myotubularin controls desmin intermediate filament architecture and mitochondrial dynamics in human and mouse skeletal muscle. J. Clin. Invest. (0021-9738) 2011 mimix curation Hnia K., Tronchère H., Tomczak K.K., Amoasii L., Schultz P., Beggs A.H., Payrastre B., Mandel J.L., Laporte J. mtm@igbmc.fr 02-Aug-2013: Contacted by IntAct-Help. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Hnia K., Tronchère H., Tomczak K.K., Amoasii L., Schultz P., Beggs A.H., Payrastre B., Mandel J.L., Laporte J. Recombinant DESMIN - as provided by Dr. H. Bar - was found to be Human in origin - Bar et al., 2005. mtm@igbmc.fr Accepted 2013-JUN-25 by MGT 02-Aug-2013: Contacted by IntAct-Help. J. Clin. Invest. (0021-9738) 2011 mimix curation Myotubularin controls desmin intermediate filament architecture and mitochondrial dynamics in human and mouse skeletal muscle. Myotubularin controls desmin intermediate filament architecture and mitochondrial dynamics in human and mouse skeletal muscle. J. Clin. Invest. (0021-9738) 2011 mimix curation Hnia K., Tronchère H., Tomczak K.K., Amoasii L., Schultz P., Beggs A.H., Payrastre B., Mandel J.L., Laporte J. mtm@igbmc.fr 02-Aug-2013: Contacted by IntAct-Help. mouse-myotubes Mus musculus myotube myotube - multi-nucleated muscle fibers formed by fused myoblasts anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hnia K., Tronchère H., Tomczak K.K., Amoasii L., Schultz P., Beggs A.H., Payrastre B., Mandel J.L., Laporte J. mtm@igbmc.fr Accepted 2013-JUN-25 by MGT 02-Aug-2013: Contacted by IntAct-Help. J. Clin. Invest. (0021-9738) 2011 mimix curation Myotubularin controls desmin intermediate filament architecture and mitochondrial dynamics in human and mouse skeletal muscle. Myotubularin controls desmin intermediate filament architecture and mitochondrial dynamics in human and mouse skeletal muscle. J. Clin. Invest. (0021-9738) 2011 mimix curation Hnia K., Tronchère H., Tomczak K.K., Amoasii L., Schultz P., Beggs A.H., Payrastre B., Mandel J.L., Laporte J. mtm@igbmc.fr 02-Aug-2013: Contacted by IntAct-Help. in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay western blot western blot Immuno blot Immuno blot Hnia K., Tronchère H., Tomczak K.K., Amoasii L., Schultz P., Beggs A.H., Payrastre B., Mandel J.L., Laporte J. mtm@igbmc.fr Accepted 2013-JUN-25 by MGT 02-Aug-2013: Contacted by IntAct-Help. J. Clin. Invest. (0021-9738) 2011 mimix curation Myotubularin controls desmin intermediate filament architecture and mitochondrial dynamics in human and mouse skeletal muscle. Myotubularin controls desmin intermediate filament architecture and mitochondrial dynamics in human and mouse skeletal muscle. J. Clin. Invest. (0021-9738) 2011 mimix curation Hnia K., Tronchère H., Tomczak K.K., Amoasii L., Schultz P., Beggs A.H., Payrastre B., Mandel J.L., Laporte J. mtm@igbmc.fr 02-Aug-2013: Contacted by IntAct-Help. in vitro In vitro cosedimentation cosedimentation weight by comassie molecular weight estimation by coomasie staining weight by comassie Hnia K., Tronchère H., Tomczak K.K., Amoasii L., Schultz P., Beggs A.H., Payrastre B., Mandel J.L., Laporte J. mtm@igbmc.fr Accepted 2013-JUN-25 by MGT 02-Aug-2013: Contacted by IntAct-Help. J. Clin. Invest. (0021-9738) 2011 mimix curation Myotubularin controls desmin intermediate filament architecture and mitochondrial dynamics in human and mouse skeletal muscle. Myotubularin controls desmin intermediate filament architecture and mitochondrial dynamics in human and mouse skeletal muscle. J. Clin. Invest. (0021-9738) 2011 mimix curation Hnia K., Tronchère H., Tomczak K.K., Amoasii L., Schultz P., Beggs A.H., Payrastre B., Mandel J.L., Laporte J. mtm@igbmc.fr 02-Aug-2013: Contacted by IntAct-Help. mouse-myoblast Mus musculus myoblasts myoblast myoblast - a type of embryonic progenitor cell that differentiates to give rise to muscle cells confocal microscopy confocal microscopy immunostaining immunostaining Hnia K., Tronchère H., Tomczak K.K., Amoasii L., Schultz P., Beggs A.H., Payrastre B., Mandel J.L., Laporte J. Mtm1 KO knockout (KO) mouse cell line (genetic background 129/Sv used and MTM1 wt and mutated constructs overexpressed. mtm@igbmc.fr Accepted 2013-JUN-25 by MGT 02-Aug-2013: Contacted by IntAct-Help. J. Clin. Invest. (0021-9738) 2011 mimix curation Myotubularin controls desmin intermediate filament architecture and mitochondrial dynamics in human and mouse skeletal muscle. Myotubularin controls desmin intermediate filament architecture and mitochondrial dynamics in human and mouse skeletal muscle. J. Clin. Invest. (0021-9738) 2011 mimix curation Hnia K., Tronchère H., Tomczak K.K., Amoasii L., Schultz P., Beggs A.H., Payrastre B., Mandel J.L., Laporte J. mtm@igbmc.fr 02-Aug-2013: Contacted by IntAct-Help. human-sw13vim- Homo sapiens SW13 vim- cells lacking endogenous cytoplasmic intermediate filaments sw13vim- sw13 cells lacking endogenous cytoplasmic intermediate filaments anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hnia K., Tronchère H., Tomczak K.K., Amoasii L., Schultz P., Beggs A.H., Payrastre B., Mandel J.L., Laporte J. mtm@igbmc.fr Accepted 2013-JUN-25 by MGT 02-Aug-2013: Contacted by IntAct-Help. J. Clin. Invest. (0021-9738) 2011 mimix curation Myotubularin controls desmin intermediate filament architecture and mitochondrial dynamics in human and mouse skeletal muscle. Myotubularin controls desmin intermediate filament architecture and mitochondrial dynamics in human and mouse skeletal muscle. J. Clin. Invest. (0021-9738) 2011 mimix curation Hnia K., Tronchère H., Tomczak K.K., Amoasii L., Schultz P., Beggs A.H., Payrastre B., Mandel J.L., Laporte J. mtm@igbmc.fr 02-Aug-2013: Contacted by IntAct-Help. human-skeletal-muscle Homo sapiens skeletal muscle. skeletal_muscle Skeletal muscle confocal microscopy confocal microscopy immunostaining immunostaining Hnia K., Tronchère H., Tomczak K.K., Amoasii L., Schultz P., Beggs A.H., Payrastre B., Mandel J.L., Laporte J. mtm@igbmc.fr Accepted 2013-JUN-25 by MGT 02-Aug-2013: Contacted by IntAct-Help. J. Clin. Invest. (0021-9738) 2011 mimix curation Myotubularin controls desmin intermediate filament architecture and mitochondrial dynamics in human and mouse skeletal muscle. Myotubularin controls desmin intermediate filament architecture and mitochondrial dynamics in human and mouse skeletal muscle. J. Clin. Invest. (0021-9738) 2011 mimix curation Hnia K., Tronchère H., Tomczak K.K., Amoasii L., Schultz P., Beggs A.H., Payrastre B., Mandel J.L., Laporte J. mtm@igbmc.fr 02-Aug-2013: Contacted by IntAct-Help. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Hnia K., Tronchère H., Tomczak K.K., Amoasii L., Schultz P., Beggs A.H., Payrastre B., Mandel J.L., Laporte J. mtm@igbmc.fr Accepted 2013-JUN-25 by MGT 02-Aug-2013: Contacted by IntAct-Help. J. Clin. Invest. (0021-9738) 2011 mimix curation Myotubularin controls desmin intermediate filament architecture and mitochondrial dynamics in human and mouse skeletal muscle. Myotubularin controls desmin intermediate filament architecture and mitochondrial dynamics in human and mouse skeletal muscle. J. Clin. Invest. (0021-9738) 2011 mimix curation Hnia K., Tronchère H., Tomczak K.K., Amoasii L., Schultz P., Beggs A.H., Payrastre B., Mandel J.L., Laporte J. mtm@igbmc.fr 02-Aug-2013: Contacted by IntAct-Help. ecoli Escherichia coli (strain K12) electrophoresis electrophoretic mobility-based method electrophoresis western blot western blot Immuno blot Immuno blot Hnia K., Tronchère H., Tomczak K.K., Amoasii L., Schultz P., Beggs A.H., Payrastre B., Mandel J.L., Laporte J. Recombinant DESMIN - as provided by Dr. H. Bar - was found to be Human in origin - Bar et al., 2005. mtm@igbmc.fr Accepted 2013-JUN-25 by MGT 02-Aug-2013: Contacted by IntAct-Help. J. Clin. Invest. (0021-9738) 2011 mimix curation Myotubularin controls desmin intermediate filament architecture and mitochondrial dynamics in human and mouse skeletal muscle. Myotubularin controls desmin intermediate filament architecture and mitochondrial dynamics in human and mouse skeletal muscle. J. Clin. Invest. (0021-9738) 2011 mimix curation Hnia K., Tronchère H., Tomczak K.K., Amoasii L., Schultz P., Beggs A.H., Payrastre B., Mandel J.L., Laporte J. mtm@igbmc.fr 02-Aug-2013: Contacted by IntAct-Help. mouse-c2c12 Mouse C3H muscle myoblast c2c12 Mouse C3H muscle myoblast confocal microscopy confocal microscopy immunostaining immunostaining Hnia K., Tronchère H., Tomczak K.K., Amoasii L., Schultz P., Beggs A.H., Payrastre B., Mandel J.L., Laporte J. mtm@igbmc.fr Accepted 2013-JUN-25 by MGT 02-Aug-2013: Contacted by IntAct-Help. J. Clin. Invest. (0021-9738) 2011 mimix curation Myotubularin controls desmin intermediate filament architecture and mitochondrial dynamics in human and mouse skeletal muscle. Myotubularin controls desmin intermediate filament architecture and mitochondrial dynamics in human and mouse skeletal muscle. J. Clin. Invest. (0021-9738) 2011 mimix curation Hnia K., Tronchère H., Tomczak K.K., Amoasii L., Schultz P., Beggs A.H., Payrastre B., Mandel J.L., Laporte J. mtm@igbmc.fr 02-Aug-2013: Contacted by IntAct-Help. chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hnia K., Tronchère H., Tomczak K.K., Amoasii L., Schultz P., Beggs A.H., Payrastre B., Mandel J.L., Laporte J. mtm@igbmc.fr Accepted 2013-JUN-25 by MGT 02-Aug-2013: Contacted by IntAct-Help. J. Clin. Invest. (0021-9738) 2011 mimix curation Myotubularin controls desmin intermediate filament architecture and mitochondrial dynamics in human and mouse skeletal muscle. Myotubularin controls desmin intermediate filament architecture and mitochondrial dynamics in human and mouse skeletal muscle. J. Clin. Invest. (0021-9738) 2011 mimix curation Hnia K., Tronchère H., Tomczak K.K., Amoasii L., Schultz P., Beggs A.H., Payrastre B., Mandel J.L., Laporte J. mtm@igbmc.fr 02-Aug-2013: Contacted by IntAct-Help. mouse-skeletal-muscle Mus musculus skeletal muscle. skeletal_muscle Skeletal muscle anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hnia K., Tronchère H., Tomczak K.K., Amoasii L., Schultz P., Beggs A.H., Payrastre B., Mandel J.L., Laporte J. mtm@igbmc.fr Accepted 2013-JUN-25 by MGT 02-Aug-2013: Contacted by IntAct-Help. J. Clin. Invest. (0021-9738) 2011 mimix curation Myotubularin controls desmin intermediate filament architecture and mitochondrial dynamics in human and mouse skeletal muscle. Myotubularin controls desmin intermediate filament architecture and mitochondrial dynamics in human and mouse skeletal muscle. J. Clin. Invest. (0021-9738) 2011 mimix curation Hnia K., Tronchère H., Tomczak K.K., Amoasii L., Schultz P., Beggs A.H., Payrastre B., Mandel J.L., Laporte J. mtm@igbmc.fr 02-Aug-2013: Contacted by IntAct-Help. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Hnia K., Tronchère H., Tomczak K.K., Amoasii L., Schultz P., Beggs A.H., Payrastre B., Mandel J.L., Laporte J. mtm@igbmc.fr Accepted 2013-JUN-25 by MGT 02-Aug-2013: Contacted by IntAct-Help. Fetal and adult skeletal muscle library J. Clin. Invest. (0021-9738) 2011 mimix curation Myotubularin controls desmin intermediate filament architecture and mitochondrial dynamics in human and mouse skeletal muscle. Myotubularin controls desmin intermediate filament architecture and mitochondrial dynamics in human and mouse skeletal muscle. J. Clin. Invest. (0021-9738) 2011 mimix curation Hnia K., Tronchère H., Tomczak K.K., Amoasii L., Schultz P., Beggs A.H., Payrastre B., Mandel J.L., Laporte J. mtm@igbmc.fr 02-Aug-2013: Contacted by IntAct-Help. mouse-skeletal-muscle Mus musculus skeletal muscle. skeletal_muscle Skeletal muscle confocal microscopy confocal microscopy immunostaining immunostaining Hnia K., Tronchère H., Tomczak K.K., Amoasii L., Schultz P., Beggs A.H., Payrastre B., Mandel J.L., Laporte J. mtm@igbmc.fr Accepted 2013-JUN-25 by MGT 02-Aug-2013: Contacted by IntAct-Help. J. Clin. Invest. (0021-9738) 2011 mimix curation mtm1_human Myotubularin MTM1 CG2 Phosphatidylinositol-3,5-bisphosphate 3-phosphatase Phosphatidylinositol-3-phosphate phosphatase protein protein human Homo sapiens Human MASASTSKYNSHSLENESIKRTSRDGVNRDLTEAVPRLPGETLITDKEVIYICPFNGPIKGRVYITNYRLYLRSLETDSSLILDVPLGVISRIEKMGGATSRGENSYGLDITCKDMRNLRFALKQEGHSRRDMFEILTRYAFPLAHSLPLFAFLNEEKFNVDGWTVYNPVEEYRRQGLPNHHWRITFINKCYELCDTYPALLVVPYRASDDDLRRVATFRSRNRIPVLSWIHPENKTVIVRCSQPLVGMSGKRNKDDEKYLDVIRETNKQISKLTIYDARPSVNAVANKATGGGYESDDAYHNAELFFLDIHNIHVMRESLKKVKDIVYPNVEESHWLSSLESTHWLEHIKLVLTGAIQVADKVSSGKSSVLVHCSDGWDRTAQLTSLAMLMLDSFYRSIEGFEILVQKEWISFGHKFASRIGHGDKNHTDADRSPIFLQFIDCVWQMSKQFPTAFEFNEQFLIIILDHLYSCRFGTFLFNCESARERQKVTERTVSLWSLINSNKEKFKNPFYTKEINRVLYPVASMRHLELWVNYYIRWNPRIKQQQPNPVEQRYMELLALRDEYIKRLEELQLANSAKLSDPPTSPSSPSQMMPHVQTHF DIP protein Q13496 original sequence version: 152 BE9770F2471957C0 desm_mouse Desmin Des protein protein mouse Mus musculus Mouse MSQAYSSSQRVSSYRRTFGGAPGFSLGSPLSSPVFPRAGFGTKGSSSSMTSRVYQVSRTSGGAGGLGSLRSSRLGTTRAPSYGAGELLDFSLADAVNQEFLATRTNEKVELQELNDRFANYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEEMRELRRQVEVLTNQRARVDVERDNLIDDLQRLKAKLQEEIQLREEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEANGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTFSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL 58A8A13C7CC11EEF mtm1_mouse Myotubularin Mtm1 Phosphatidylinositol-3,5-bisphosphate 3-phosphatase Phosphatidylinositol-3-phosphate phosphatase protein protein mouse Mus musculus Mouse MASASASKYNSHSLENESIKKVSQDGVSQDVSETVPRLPGELLITEKEVIYICPFNGPIKGRVYITNYRLYLRSLETDSALILDVPLGVISRIEKMGGATSRGENSYGLDITCKDLRNLRFALKQEGHSRRDMFEILVKHAFPLAHNLPLFAFVNEEKFNVDGWTVYNPVEEYRRQGLPNHHWRISFINKCYELCETYPALLVVPYRTSDDDLRRIATFRSRNRLPVLSWIHPENKMVIMRCSQPLVGMSGKRNKDDEKYLDVIRETNKQTSKLMIYDARPSVNAVANKATGGGYESDDAYQNSELSFLDIHNIHVMRESLKKVKDIVYPNIEESHWLSSLESTHWLEHIKLVLTGAIQVADQVSSGKSSVLVHCSDGWDRTAQLTSLAMLMLDSFYRTIEGFEILVQKEWISFGHKFASRIGHGDKNHADADRSPIFLQFIDCVWQMSKQFPTAFEFNEGFLITVLDHLYSCRFGTFLFNCDSARERQKLTERTVSLWSLINSNKDKFKNPFYTKEINRVLYPVASMRHLELWVNYYIRWNPRVKQQQPNPVEQRYMELLALRDDYIKRLEELQLANSAKLADAPASTSSSSQMVPHVQTHF 65929312F07FFCC7 desm_human Desmin DES protein protein human Homo sapiens Human MSQAYSSSQRVSSYRRTFGGAPGFPLGSPLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTRTPSSYGAGELLDFSLADAVNQEFLTTRTNEKVELQELNDRFANYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEELRELRRQVEVLTNQRARVDVERDNLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL 1B5D9EA93C3BB319 plec_mouse Plectin Plectin-6 Plec Plec1 Plectin-1 protein protein mouse Mus musculus Mouse MVAGMLMPLDRLRAIYEVLFREGVMVAKKDRRPRSLHPHVPGVTNLQVMRAMASLKARGLVRETFAWCHFYWYLTNEGIDHLRQYLHLPPEIVPASLQRVRRPVAMVIPARRRSPHVQTMQGPLGCPPKRGPLPAEDPAREERQVYRRKEREEGAPETPVVSATTVGTLARPGPEPAPATDERDRVQKKTFTKWVNKHLIKHWRAEAQRHISDLYEDLRDGHNLISLLEVLSGDSLPREKGRMRFHKLQNVQIALDYLRHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQISDIQVSGQSEDMTAKEKLLLWSQRMVEGYQGLRCDNFTTSWRDGRLFNAIIHRHKPMLIDMNKVYRQTNLENLDQAFSVAERDLGVTRLLDPEDVDVPQPDEKSIITYVSSLYDAMPRVPGAQDGVRANELQLRWQEYRELVLLLLQWIRHHTAAFEERKFPSSFEEIEILWCQFLKFKETELPAKEADKNRSKVIYQSLEGAVQAGQLKIPPGYHPLDVEKEWGKLHVAILEREKQLRSEFERLECLQRIVSKLQMEAGLCEEQLNQADALLQSDIRLLASGKVAQRAGEVERDLDKADGMIRLLFNDVQTLKDGRHPQGEQMYRRVYRLHERLVAIRTEYNLRLKAGVGAPVTQVTLQSTQRRPELEDSTLRYLQDLLAWVEENQRRIDSAEWGVDLPSVEAQLGSHRGMHQSIEEFRAKIERARNDESQLSPATRGAYRDCLGRLDLQYAKLLNSSKARLRSLESLHGFVAAATKELMWLNEKEEEEVGFDWSDRNTNMAAKKESYSALMRELEMKEKKIKEIQNTGDRLLREDHPARPTVESFQAALQTQWSWMLQLCCCIEAHLKENTAYFQFFSDVREAEEQLQKLQETLRRKYSCDRTITVTRLEDLLQDAQDEKEQLNEYKGHLSGLAKRAKAIVQLKPRNPAHPVRGHVPLIAVCDYKQVEVTVHKGDQCQLVGPAQPSHWKVLSGSSSEAAVPSVCFLVPPPNQEAQEAVARLEAQHQALVTLWHQLHVDMKSLLAWQSLSRDIQLIRSWSLVTFRTLKPEEQRQALRNLELHYQAFLRDSQDAGGFGPEDRLVAEREYGSCSRHYQQLLQSLEQGEQEESRCQRCISELKDIRLQLEACETRTVHRLRLPLDKDPARECAQRIAEQQKAQAEVEGLGKGVARLSAEAEKVLALPEPSPAAPTLRSELELTLGKLEQVRSLSAIYLEKLKTISLVIRSTQGAEEVLKTHEEQLKEAQAVPATLQELEATKASLKKLRAQAEAQQPVFNTLRDELRGAQEVGERLQQRHGERDVEVERWRERVTQLLERWQAVLAQTDVRQRELEQLGRQLRYYRESADPLSAWLQDAKRRQEQIQAVPIANCQAAREQLRQEKALLEEIERHGEKVEECQKFAKQYINAIKDYELQLITYKAQLEPVASPAKKPKVQSGSESVIQEYVDLRTRYSELTTLTSQYIKFISETLRRMEEEERLAEQQRAEERERLAEVEAALEKQRQLAEAHAQAKAQAELEAQELQRRMQEEVARREEAAVDAQQQKRSIQEELQHLRQSSEAEIQAKAQQVEAAERSRMRIEEEIRVVRLQLETTERQRGGAEGELQALRARAEEAEAQKRQAQEEAERLRRQVQDESQRKRQAEAELALRVKAEAEAAREKQRALQALDELRLQAEEAERRLRQAEAERARQVQVALETAQRSAEVELQSKRASFAEKTAQLERTLQEEHVTVAQLREEAERRAQQQAEAERAREEAERELERWQLKANEALRLRLQAEEVAQQKSLAQADAEKQKEEAEREARRRGKAEEQAVRQRELAEQELEKQRQLAEGTAQQRLAAEQELIRLRAETEQGEQQRQLLEEELARLQHEATAATQKRQELEAELAKVRAEMEVLLASKARAEEESRSTSEKSKQRLEAEAGRFRELAEEAARLRALAEEAKRQRQLAEEDAARQRAEAERVLTEKLAAISEATRLKTEAEIALKEKEAENERLRRLAEDEAFQRRRLEEQAALHKADIEERLAQLRKASESELERQKGLVEDTLRQRRQVEEEIMALKVSFEKAAAGKAELELELGRIRSNAEDTMRSKEQAELEAARQRQLAAEEEQRRREAEERVQRSLAAEEEAARQRKVALEEVERLKAKVEEARRLRERAEQESARQLQLAQEAAQKRLQAEEKAHAFVVQQREEELQQTLQQEQNMLDRLRSEAEAARRAAEEAEEAREQAEREAAQSRKQVEEAERLKQSAEEQAQAQAQAQAAAEKLRKEAEQEAARRAQAEQAALKQKQAADAEMEKHKKFAEQTLRQKAQVEQELTTLRLQLEETDHQKSILDEELQRLKAEVTEAARQRSQVEEELFSVRVQMEELGKLKARIEAENRALILRDKDNTQRFLEEEAEKMKQVAEEAARLSVAAQEAARLRQLAEEDLAQQRALAEKMLKEKMQAVQEATRLKAEAELLQQQKELAQEQARRLQEDKEQMAQQLVEETQGFQRTLEAERQRQLEMSAEAERLKLRMAEMSRAQARAEEDAQRFRKQAEEIGEKLHRTELATQEKVTLVQTLEIQRQQSDHDAERLREAIAELEREKEKLKQEAKLLQLKSEEMQTVQQEQILQETQALQKSFLSEKDSLLQRERFIEQEKAKLEQLFQDEVAKAKQLREEQQRQQQQMEQEKQELMASMEEARRRQREAEEGVRRKQEELQHLEQQRQQQEKLLAEENQRLRERLQRLEEEHRAALAHSEIATTQAASTKALPNGRDAPDGPSVEAEPEYTFEGLRQKVPAQQLQEAGILSQEELQRLAQGHTTVAELTQREDVYRYLKGRSSIAGLLLKPTNEKLSVYTALQRQLLSPGTALILLEAQAASGFLLDPVRNRRLTVNEAVKEGVVGPELHHKLLSAERAVTGYKDPYTGEQISLFQAMKKDLIVRDHGVRLLEAQIATGGIIDPVHSHRVPVDVAYKRGYFDEEMNRILSDPSDDTKGFFDPNTHENLTYLQLLERCVEDPETGLRLLPLTDKAAKGGELVYTDTEARDVFEKATVSAPFGKFQGRTVTIWEIINSEYFTAEQRRDLLQQFRTGHITVEKIIKIVITVVEEHERKGQLCFEGLRALVPAAELLDSGVISHELYQQLQRGERSVREVAEADSVRQALRGTNVIAGVWLEEAGQKLSIYEALKKDLLQPEVAVALLEAQAGTGHIIDPATSARLTVDEAVRAGLVGPELHEKLLSAEKAVTGYRDPYSGQSVSLFQALKKGLIPREQGLRLLDAQLSTGGIVDPSKSHRVPLDVAYARGYLDKETNRALTSPRDDARVYHDPSTQEPVTYSQLQQRCRSDQLTGLSLLPLSEKAVRARQEEVYSELQARETLEQAKVEVPVGSFKGRAMTVWELISSEYFTEEQRQELLRQFRTGKVTVEKVIKIVITIVEEVETRRQERLSFSGLRAPVPASELLDAKILSRAQFDQLKDGKTSVKELSEVGSVRTLLQGSGCLAGIYLEDSKEKVTIYEAMRRGLLRPSTATLLLEAQAATGFLVDPVRNQRLYVHEAVKAGVVGPELHEKLLSAEKAVTGYKDPYSGNTISLFQAMKKGLVLRDHAIRLLEAQVATGGIIDPVHSHRLPVDVAYQRGYFDEEMNRVLADPSDDTKGFFDPNTHENLTYLQLLERCVEDPETGLRLLPLKGAEKTEVVETTQVYTEEETRRAFEETQIDIPGGGSHGGSSMSLWEVMQSNMIPEDQRARLMADFQAGRVTKERMIIIIIEIIEKTEIIRQQNLASYDYVRRRLTAEDLYEARIISLETYNLFREGTKNLREVLEMESAWRYLYGTGAVAGVYLPGSRQTLTIYQALKKGLLSAEVARLLLEAQAATGFLLDPVKGERLTVDEAVRKGLVGPELHDRLLSAERAVTGYRDPYTEQTISLFQAMKKELIPAEEALRLLDAQLATGGIVDPRLGFHLPLEVAYQRGYLNKDTHDQLSEPSEVRSYVDPSTDERLSYTQLLKRCRRDDPSGQMLLLLSDARKLTFRGLRKQITVEELVRSQVMDEATALQLQEGLTSIEEVTKNLQKFLEGTSCIAGVFVDATKERLSVYQAMKKGIIRPGTAFELLEAQAATGYVIDPIKGLKLTVEEAVRMGIVGPEFKDKLLSAERAVTGYKDPYSGKLISLFQAMKKGLILKDHGIRLLEAQIATGGIIDPEESHRLPVEVAYKRGLFDEEMNEILTDPSDDTKGFFDPNTEENLTYLQLMERCITDPQTGLCLLPLKEKKRERKTSSKSSVRKRRVVIVDPETGKEMSVYEAYRKGLIDHQTYLELSEQECEWEEITISSSDGVVKSMIIDRRSGRQYDIDDAITKNLIDRSALDQYRAGTLSITEFADMLSGNAGGFRSRSSSVGSSSSYPISSAGPRTQLASWSDPTEETGPVAGILDTETLEKVSITEAMHRNLVDNITGQRLLEAQACTGGIIDPSTGERFPVTEAVNKGLVDKIMVDRINLAQKAFCGFEDPRTKTKMSAAQALKKGWLYYEAGQRFLEVQYLTGGLIEPDTPGRVSLDEALQRGTVDARTAQKLRDVSAYSKYLTCPKTKLKISYKDALDRSMVEEGTGLRLLEAAAQSSKGYYSPYSVSGSGSTAGSRTGSRTGSRAGSRRGSFDATGSGFSMTFSSSSYSSSGYGRRYASGPSASLGGPESAVA 91A09EC8181137D1 mtm1-des 14 16 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey physical association physical association no figure mtm1-des-2 9 17 unspecified role unspecified role prey prey mouse-skeletal-muscle Mus musculus skeletal muscle. skeletal_muscle Skeletal muscle 16 unspecified role unspecified role bait bait physical association physical association 1A mtm1-des-3 9 17 unspecified role unspecified role prey prey mouse-myotubes Mus musculus myotube myotube - multi-nucleated muscle fibers formed by fused myoblasts 16 unspecified role unspecified role bait bait physical association physical association 1A des-mtm1-7 2 19 unspecified role unspecified role prey prey P17661:p.Asn342Asp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain N D Wed May 02 16:40:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn342asp' Tue Jun 30 15:46:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn342Asp' UniProt FTId: VAR_042453 P17661:p.Ala357Pro mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain A P Wed May 02 15:32:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala357pro' Tue Jun 30 17:10:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala357Pro' UniProt FTId: VAR_042456 P17661:p.Ala360Pro mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain A P Wed May 02 18:54:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala360pro' Tue Jun 30 16:47:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala360Pro' UniProt FTId: VAR_007901 P17661:p.Leu370Pro mutation mutation certain certain sequence position certain certain certain sequence position certain L P Wed May 02 19:01:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu370pro' Tue Jun 30 20:23:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu370Pro' UniProt FTId: VAR_042457 16 unspecified role unspecified role bait bait direct interaction direct interaction 1B and 3G mtm1-des-4 12 19 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait Q13496:p.Arg184Gly mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain R G Wed May 02 14:46:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg184gly' Tue Jun 30 18:34:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg184Gly' UniProt FTId: VAR_006390 Q13496:p.Pro205Leu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain P L Wed May 02 20:26:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro205leu' Tue Jun 30 19:43:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro205Leu' UniProt FTId: VAR_006393 Q13496:p.Arg241Cys mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain R C Wed May 02 20:19:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg241cys' Tue Jun 30 17:29:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg241Cys' Q13496:p.Asp278Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain D A Wed May 02 16:44:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp278ala' Tue Jun 30 17:21:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp278Ala' physical association physical association 1C, 3F and Supp 3B. mtm1-des-5 3 18 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association 1C mtm1-des-6 13 18 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association 1C des-mtm1-1 13 17 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey physical association physical association 1C des-mtm1-2 15 18 unspecified role unspecified role neutral component neutral component 17 unspecified role unspecified role neutral component neutral component colocalization colocalization 1D and 4D mtm1-des-7 9 16 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 physical association physical association 2A des-des 8 16 unspecified role unspecified role neutral component neutral component 19 unspecified role unspecified role neutral component neutral component colocalization colocalization S1 des-mtm1-3 4 16 unspecified role unspecified role prey prey 19 unspecified role unspecified role bait bait direct interaction direct interaction S3D des-mtm1-4 4 19 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait direct interaction direct interaction S3F and 2D des-mtm1-6 5 19 unspecified role unspecified role neutral component neutral component purified purified 16 unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction 5C mtm1-des-9 7 16 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey physical association physical association 6B plec-des 13 20 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey physical association physical association 8F mtm1-des-13 1 19 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait physical association physical association S3C and 2B mtm1-des-11 9 16 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association S3E mtm1-des-12 2 16 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey direct interaction direct interaction 1B des-des-2 5 16 competitor competitor competitor neutral component neutral component purified purified 19 unspecified role unspecified role neutral component neutral component purified purified 19 unspecified role unspecified role neutral component neutral component physical association physical association 5D Polymerized form of desmin. des-mtm1-9 6 17 unspecified role unspecified role neutral component neutral component 16 unspecified role unspecified role neutral component neutral component colocalization colocalization S7A and 8A des-mtm1-10 11 17 unspecified role unspecified role neutral component neutral component 16 unspecified role unspecified role neutral component neutral component colocalization colocalization S8B des-3 10 19 unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction 1B