IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ 14-3-3 beta in the healthy and diseased male reproductive system. 14-3-3 beta in the healthy and diseased male reproductive system. Hum. Reprod. (0268-1161) 2011 imex curation Graf M., Brobeil A., Sturm K., Steger K., Wimmer M. Affinomics - Interactions curated for the Affinomics consortium. michaela.graf@anatomie.med.uni-giessen.de 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions rat-testis Rat testis testis pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Graf M., Brobeil A., Sturm K., Steger K., Wimmer M. Affinomics - Interactions curated for the Affinomics consortium. michaela.graf@anatomie.med.uni-giessen.de Accepted 2014-JAN-09 by ORCHARD Hum. Reprod. (0268-1161) 2011 Only protein-protein interactions imex curation 14-3-3 beta in the healthy and diseased male reproductive system. 14-3-3 beta in the healthy and diseased male reproductive system. Hum. Reprod. (0268-1161) 2011 imex curation Graf M., Brobeil A., Sturm K., Steger K., Wimmer M. Affinomics - Interactions curated for the Affinomics consortium. michaela.graf@anatomie.med.uni-giessen.de 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions rat-testis Rat testis testis anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Graf M., Brobeil A., Sturm K., Steger K., Wimmer M. Affinomics - Interactions curated for the Affinomics consortium. Identity of specific tubulin was taken from commercial antibody webpage and blast of the peptide used to generate it. The longest trembl entry mapping to it was chosen. michaela.graf@anatomie.med.uni-giessen.de Accepted 2014-JAN-09 by ORCHARD Hum. Reprod. (0268-1161) 2011 Only protein-protein interactions imex curation 14-3-3 beta in the healthy and diseased male reproductive system. 14-3-3 beta in the healthy and diseased male reproductive system. Hum. Reprod. (0268-1161) 2011 imex curation Graf M., Brobeil A., Sturm K., Steger K., Wimmer M. Affinomics - Interactions curated for the Affinomics consortium. michaela.graf@anatomie.med.uni-giessen.de 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions human-testis Homo sapiens testis pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Graf M., Brobeil A., Sturm K., Steger K., Wimmer M. Affinomics - Interactions curated for the Affinomics consortium. michaela.graf@anatomie.med.uni-giessen.de Accepted 2014-JAN-09 by ORCHARD Hum. Reprod. (0268-1161) 2011 Only protein-protein interactions imex curation 14-3-3 beta in the healthy and diseased male reproductive system. 14-3-3 beta in the healthy and diseased male reproductive system. Hum. Reprod. (0268-1161) 2011 imex curation Graf M., Brobeil A., Sturm K., Steger K., Wimmer M. Affinomics - Interactions curated for the Affinomics consortium. michaela.graf@anatomie.med.uni-giessen.de 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions rat-testis Rat testis testis fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Graf M., Brobeil A., Sturm K., Steger K., Wimmer M. Affinomics - Interactions curated for the Affinomics consortium. michaela.graf@anatomie.med.uni-giessen.de Accepted 2014-JAN-09 by ORCHARD Hum. Reprod. (0268-1161) 2011 Only protein-protein interactions imex curation 14-3-3 beta in the healthy and diseased male reproductive system. 14-3-3 beta in the healthy and diseased male reproductive system. Hum. Reprod. (0268-1161) 2011 imex curation Graf M., Brobeil A., Sturm K., Steger K., Wimmer M. Affinomics - Interactions curated for the Affinomics consortium. michaela.graf@anatomie.med.uni-giessen.de 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions mouse-testis Mus musculus testis testis pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Graf M., Brobeil A., Sturm K., Steger K., Wimmer M. Affinomics - Interactions curated for the Affinomics consortium. michaela.graf@anatomie.med.uni-giessen.de Accepted 2014-JAN-09 by ORCHARD Hum. Reprod. (0268-1161) 2011 Only protein-protein interactions imex curation 14-3-3 beta in the healthy and diseased male reproductive system. 14-3-3 beta in the healthy and diseased male reproductive system. Hum. Reprod. (0268-1161) 2011 imex curation Graf M., Brobeil A., Sturm K., Steger K., Wimmer M. Affinomics - Interactions curated for the Affinomics consortium. michaela.graf@anatomie.med.uni-giessen.de 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions mouse-testis Mus musculus testis testis fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Graf M., Brobeil A., Sturm K., Steger K., Wimmer M. Affinomics - Interactions curated for the Affinomics consortium. michaela.graf@anatomie.med.uni-giessen.de Accepted 2014-JAN-09 by ORCHARD Hum. Reprod. (0268-1161) 2011 Only protein-protein interactions imex curation 14-3-3 beta in the healthy and diseased male reproductive system. 14-3-3 beta in the healthy and diseased male reproductive system. Hum. Reprod. (0268-1161) 2011 imex curation Graf M., Brobeil A., Sturm K., Steger K., Wimmer M. Affinomics - Interactions curated for the Affinomics consortium. michaela.graf@anatomie.med.uni-giessen.de 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions human-testis Homo sapiens testis fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Graf M., Brobeil A., Sturm K., Steger K., Wimmer M. Affinomics - Interactions curated for the Affinomics consortium. michaela.graf@anatomie.med.uni-giessen.de Accepted 2014-JAN-09 by ORCHARD Hum. Reprod. (0268-1161) 2011 Only protein-protein interactions imex curation 1433b_human 14-3-3 protein beta/alpha YWHAB Protein kinase C inhibitor protein 1 Protein 1054 protein protein human Homo sapiens Human MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN DIP protein P31946 original sequence version: 171 DIP protein P31946 original sequence version: 97 DIP protein P31946 original sequence version: 119 DIP protein P31946 original sequence version: 122 DIP protein P31946 original sequence version: 180 6BE1A9BF97468017 vime_mouse Vimentin Vim protein protein mouse Mus musculus Mouse MSTRSVSSSSYRRMFGGSGTSSRPSSNRSYVTTSTRTYSLGSALRPSTSRSLYSSSPGGAYVTRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKLQEEMLQREEAESTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHDEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESNEYRRQVQSLTCEVDALKGTNESLERQMREMEENFALEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPTFSSLNLRETNLESLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE A94EECEA6D70C899 1433b_mouse 14-3-3 protein beta/alpha Protein kinase C inhibitor protein 1 Ywhab protein protein mouse Mus musculus Mouse MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLILNATQAESKVFYLKMKGDYFRYLSEVASGENKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN 51C366ED85B38EED 1433b_rat 14-3-3 protein beta/alpha Protein kinase C inhibitor protein 1 Prepronerve growth factor RNH-1 Ywhab protein protein rat Rattus norvegicus (Rat) Rat MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICSDVLELLDKYLILNATHAESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN B663D1F2182F9C43 vime_human Vimentin VIM protein protein human Homo sapiens Human MSTRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPSTSRSLYASSPGGVYATRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKLQEEMLQREEAENTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSSLNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE DIP protein P08670 original sequence version: 195 DIP protein P08670 original sequence version: 209 DIP protein P08670 original sequence version: 192 DIP protein P08670 original sequence version: 175 BAB54026665B015A vime_rat Vimentin Vim protein protein rat Rattus norvegicus (Rat) Rat MSTRSVSSSSYRRMFGGSGTSSRPSSNRSYVTTSTRTYSLGSALRPSTSRSLYSSSPGGAYVTRSSAVRLRSSMPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKLQEEMLQREEAESTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHDEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESNEYRRQVQSLTCEVDALKGTNESLERQMREMEENFALEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSSLNLRETNLESLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE DIP protein P31000 original sequence version: 140 501CDCD706166829 b4f7c2_rat Tubulin beta chain Tubb4a Tubb4 rCG_45085 protein protein rat Rattus norvegicus (Rat) Rat MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEGEFEEEAEEEVA F7429D057C11A3F5 vim-ywhab 7 8 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component colocalization colocalization 2c vim-ywhab-1 3 8 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 4a vim-ywhab-2 4 11 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component colocalization colocalization 2g vim-ywhab-3 1 11 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 4b ywhab-tubb4a 2 14 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait association association 5 vim-ywhab-4 6 9 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component colocalization colocalization 2k vim-ywhab-5 5 9 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 4c