IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ ARHGEF7 (Beta-PIX) acts as guanine nucleotide exchange factor for leucine-rich repeat kinase 2. ARHGEF7 (Beta-PIX) acts as guanine nucleotide exchange factor for leucine-rich repeat kinase 2. PLoS ONE 2010 imex curation Haebig K., Gloeckner C.J., Miralles M.G., Gillardon F., Schulte C., Riess O., Ueffing M., Biskup S., Bonin M. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease saskia.biskup@medizin.uni-tuebingen.de,michael.bonin@med.uni-tuebingen.de 01-March-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Haebig K., Gloeckner C.J., Miralles M.G., Gillardon F., Schulte C., Riess O., Ueffing M., Biskup S., Bonin M. Parkinsons - Interactions investigated in the context of Parkinsons disease saskia.biskup@medizin.uni-tuebingen.de,michael.bonin@med.uni-tuebingen.de Accepted 2013-FEB-20 by ORCHARD 01-March-2013: Contacted by IntAct-Help. PLoS ONE 2010 Only protein-protein interactions imex curation ARHGEF7 (Beta-PIX) acts as guanine nucleotide exchange factor for leucine-rich repeat kinase 2. ARHGEF7 (Beta-PIX) acts as guanine nucleotide exchange factor for leucine-rich repeat kinase 2. PLoS ONE 2010 imex curation Haebig K., Gloeckner C.J., Miralles M.G., Gillardon F., Schulte C., Riess O., Ueffing M., Biskup S., Bonin M. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease saskia.biskup@medizin.uni-tuebingen.de,michael.bonin@med.uni-tuebingen.de 01-March-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom anti tag western anti tag western blot anti tag western Haebig K., Gloeckner C.J., Miralles M.G., Gillardon F., Schulte C., Riess O., Ueffing M., Biskup S., Bonin M. Parkinsons - Interactions investigated in the context of Parkinsons disease saskia.biskup@medizin.uni-tuebingen.de,michael.bonin@med.uni-tuebingen.de Accepted 2013-FEB-20 by ORCHARD 01-March-2013: Contacted by IntAct-Help. PLoS ONE 2010 Only protein-protein interactions imex curation ARHGEF7 (Beta-PIX) acts as guanine nucleotide exchange factor for leucine-rich repeat kinase 2. ARHGEF7 (Beta-PIX) acts as guanine nucleotide exchange factor for leucine-rich repeat kinase 2. PLoS ONE 2010 imex curation Haebig K., Gloeckner C.J., Miralles M.G., Gillardon F., Schulte C., Riess O., Ueffing M., Biskup S., Bonin M. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease saskia.biskup@medizin.uni-tuebingen.de,michael.bonin@med.uni-tuebingen.de 01-March-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Haebig K., Gloeckner C.J., Miralles M.G., Gillardon F., Schulte C., Riess O., Ueffing M., Biskup S., Bonin M. Parkinsons - Interactions investigated in the context of Parkinsons disease not sure about LRRK2 tags nor origin of LRRK2 - nothing stated so I have assumed they are the same tags/origin as before....(though the ARHGEF7 tags DO change). It might be better to omit this GTPAse assay altogether as a cell lysate is definitly the souce of ARHGEF7, even if it is relatively pure - Tandem tag purification) - so there might be potential contaminants? However it is a tande saskia.biskup@medizin.uni-tuebingen.de,michael.bonin@med.uni-tuebingen.de Accepted 2013-FEB-20 by ORCHARD 01-March-2013: Contacted by IntAct-Help. PLoS ONE 2010 Only protein-protein interactions imex curation ARHGEF7 (Beta-PIX) acts as guanine nucleotide exchange factor for leucine-rich repeat kinase 2. ARHGEF7 (Beta-PIX) acts as guanine nucleotide exchange factor for leucine-rich repeat kinase 2. PLoS ONE 2010 imex curation Haebig K., Gloeckner C.J., Miralles M.G., Gillardon F., Schulte C., Riess O., Ueffing M., Biskup S., Bonin M. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease saskia.biskup@medizin.uni-tuebingen.de,michael.bonin@med.uni-tuebingen.de 01-March-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay sequence tag sequence tag identification sequence tag Haebig K., Gloeckner C.J., Miralles M.G., Gillardon F., Schulte C., Riess O., Ueffing M., Biskup S., Bonin M. Parkinsons - Interactions investigated in the context of Parkinsons disease The gel shows that the mutant LRRK2 (K1906M) that was purified in the same manner has NO activity - I know that Pablo did not like this, but given that the LRRK2 has been tap (-ish) affinity purified and I cannot see any likely contaminants on the gel, this is good enough proof of the absence of contaminants, for me, in this instance.....?? saskia.biskup@medizin.uni-tuebingen.de,michael.bonin@med.uni-tuebingen.de Accepted 2013-FEB-20 by ORCHARD 01-March-2013: Contacted by IntAct-Help. PLoS ONE 2010 Only protein-protein interactions imex curation ARHGEF7 (Beta-PIX) acts as guanine nucleotide exchange factor for leucine-rich repeat kinase 2. ARHGEF7 (Beta-PIX) acts as guanine nucleotide exchange factor for leucine-rich repeat kinase 2. PLoS ONE 2010 imex curation Haebig K., Gloeckner C.J., Miralles M.G., Gillardon F., Schulte C., Riess O., Ueffing M., Biskup S., Bonin M. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease saskia.biskup@medizin.uni-tuebingen.de,michael.bonin@med.uni-tuebingen.de 01-March-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Haebig K., Gloeckner C.J., Miralles M.G., Gillardon F., Schulte C., Riess O., Ueffing M., Biskup S., Bonin M. Parkinsons - Interactions investigated in the context of Parkinsons disease The gel shows that the mutant LRRK2 (K1906M) that was purified in the same manner has NO activity - I know that Pablo did not like this, but given that the LRRK2 has been tap (-ish) affinity purified and I cannot see any likely contaminants on the gel, this is good enough proof of the absence of contaminants, for me, in this instance.....?? saskia.biskup@medizin.uni-tuebingen.de,michael.bonin@med.uni-tuebingen.de Accepted 2013-FEB-20 by ORCHARD 01-March-2013: Contacted by IntAct-Help. PLoS ONE 2010 Only protein-protein interactions imex curation ARHGEF7 (Beta-PIX) acts as guanine nucleotide exchange factor for leucine-rich repeat kinase 2. ARHGEF7 (Beta-PIX) acts as guanine nucleotide exchange factor for leucine-rich repeat kinase 2. PLoS ONE 2010 imex curation Haebig K., Gloeckner C.J., Miralles M.G., Gillardon F., Schulte C., Riess O., Ueffing M., Biskup S., Bonin M. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease saskia.biskup@medizin.uni-tuebingen.de,michael.bonin@med.uni-tuebingen.de 01-March-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Haebig K., Gloeckner C.J., Miralles M.G., Gillardon F., Schulte C., Riess O., Ueffing M., Biskup S., Bonin M. Parkinsons - Interactions investigated in the context of Parkinsons disease saskia.biskup@medizin.uni-tuebingen.de,michael.bonin@med.uni-tuebingen.de Accepted 2013-FEB-20 by ORCHARD 01-March-2013: Contacted by IntAct-Help. PLoS ONE 2010 Only protein-protein interactions imex curation ARHGEF7 (Beta-PIX) acts as guanine nucleotide exchange factor for leucine-rich repeat kinase 2. ARHGEF7 (Beta-PIX) acts as guanine nucleotide exchange factor for leucine-rich repeat kinase 2. PLoS ONE 2010 imex curation Haebig K., Gloeckner C.J., Miralles M.G., Gillardon F., Schulte C., Riess O., Ueffing M., Biskup S., Bonin M. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease saskia.biskup@medizin.uni-tuebingen.de,michael.bonin@med.uni-tuebingen.de 01-March-2013: Contacted by IntAct-Help. Only protein-protein interactions human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Haebig K., Gloeckner C.J., Miralles M.G., Gillardon F., Schulte C., Riess O., Ueffing M., Biskup S., Bonin M. Parkinsons - Interactions investigated in the context of Parkinsons disease saskia.biskup@medizin.uni-tuebingen.de,michael.bonin@med.uni-tuebingen.de Accepted 2013-FEB-20 by ORCHARD 01-March-2013: Contacted by IntAct-Help. PLoS ONE 2010 Only protein-protein interactions imex curation cdc42_mouse Cell division control protein 42 homolog Cdc42 G25K GTP-binding protein protein protein mouse Mus musculus Mouse MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL DIP protein P60766 original sequence version: 61 51A437E22A4D8FFF gtp guanosine triphosphate - GTP 5'-GTP GTP Guanosine 5'-triphosphate guanosine 5'-triphosphoric acid guanosine triphosphate GUANOSINE-5'-TRIPHOSPHATE H4gtp guanosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 arhg7_human Rho guanine nucleotide exchange factor 7 PAK-interacting exchange factor beta Beta-Pix COOL-1 p85 Nbla10314 ARHGEF7 COOL1 KIAA0142 P85SPR PAK3BP PIXB protein protein human Homo sapiens Human MNSAEQTVTWLITLGVLESPKKTISDPEGFLQASLKDGVVLCRLLERLLPGTIEKVYPEPRSESECLSNIREFLRGCGASLRLELLFPPSQPPQHLVTTILLSASTFDANDLYQGQNFNKVLSSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTLNGRTGWFPSNYVREVKASEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETENEYSKELQTVLSTYLRPLQTSEKLSSANISYLMGNLEEICSFQQMLVQSLEECTKLPEAQQRVGGCFLNLMPQMKTLYLTYCANHPSAVNVLTEHSEELGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHTDRQDIQKSMAAFKNLSAQCQEVRKRKELELQILTEAIRNWEGDDIKTLGNVTYMSQVLIQCAGSEEKNERYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSENHRNAFEISGSMIERILVSCNNQQDLQEWVEHLQKQTKVTSVGNPTIKPHSVPSHTLPSHPVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFASRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSTWQGTDLMHNHVLADDDQPSLDSLGRRSSLSRLEPSDLSEDSDYDSIWTAHSYRMGSTSRKSCCSYISHQN DIP protein Q14155 original sequence version: 163 DIP protein Q14155 original sequence version: 159 613EBA839E6FDBFD lrrk2_human Leucine-rich repeat serine/threonine-protein kinase 2 LRRK2 PARK8 Dardarin protein protein human Homo sapiens Human MASGSCQGCEEDEETLKKLIVRLNNVQEGKQIETLVQILEDLLVFTYSERASKLFQGKNIHVPLLIVLDSYMRVASVQQVGWSLLCKLIEVCPGTMQSLMGPQDVGNDWEVLGVHQLILKMLTVHNASVNLSVIGLKTLDLLLTSGKITLLILDEESDIFMLIFDAMHSFPANDEVQKLGCKALHVLFERVSEEQLTEFVENKDYMILLSALTNFKDEEEIVLHVLHCLHSLAIPCNNVEVLMSGNVRCYNIVVEAMKAFPMSERIQEVSCCLLHRLTLGNFFNILVLNEVHEFVVKAVQQYPENAALQISALSCLALLTETIFLNQDLEEKNENQENDDEGEEDKLFWLEACYKALTWHRKNKHVQEAACWALNNLLMYQNSLHEKIGDEDGHFPAHREVMLSMLMHSSSKEVFQASANALSTLLEQNVNFRKILLSKGIHLNVLELMQKHIHSPEVAESGCKMLNHLFEGSNTSLDIMAAVVPKILTVMKRHETSLPVQLEALRAILHFIVPGMPEESREDTEFHHKLNMVKKQCFKNDIHKLVLAALNRFIGNPGIQKCGLKVISSIVHFPDALEMLSLEGAMDSVLHTLQMYPDDQEIQCLGLSLIGYLITKKNVFIGTGHLLAKILVSSLYRFKDVAEIQTKGFQTILAILKLSASFSKLLVHHSFDLVIFHQMSSNIMEQKDQQFLNLCCKCFAKVAMDDYLKNVMLERACDQNNSIMVECLLLLGADANQAKEGSSLICQVCEKESSPKLVELLLNSGSREQDVRKALTISIGKGDSQIISLLLRRLALDVANNSICLGGFCIGKVEPSWLGPLFPDKTSNLRKQTNIASTLARMVIRYQMKSAVEEGTASGSDGNFSEDVLSKFDEWTFIPDSSMDSVFAQSDDLDSEGSEGSFLVKKKSNSISVGEFYRDAVLQRCSPNLQRHSNSLGPIFDHEDLLKRKRKILSSDDSLRSSKLQSHMRHSDSISSLASEREYITSLDLSANELRDIDALSQKCCISVHLEHLEKLELHQNALTSFPQQLCETLKSLTHLDLHSNKFTSFPSYLLKMSCIANLDVSRNDIGPSVVLDPTVKCPTLKQFNLSYNQLSFVPENLTDVVEKLEQLILEGNKISGICSPLRLKELKILNLSKNHISSLSENFLEACPKVESFSARMNFLAAMPFLPPSMTILKLSQNKFSCIPEAILNLPHLRSLDMSSNDIQYLPGPAHWKSLNLRELLFSHNQISILDLSEKAYLWSRVEKLHLSHNKLKEIPPEIGCLENLTSLDVSYNLELRSFPNEMGKLSKIWDLPLDELHLNFDFKHIGCKAKDIIRFLQQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKTKKSDLGMQSATVGIDVKDWPIQIRDKRKRDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDEKQRKACMSKITKELLNKRGFPAIRDYHFVNATEESDALAKLRKTIINESLNFKIRDQLVVGQLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQLVRENQLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKIMAQILTVKVEGCPKHPKGIISRRDVEKFLSKKRKFPKNYMSQYFKLLEKFQIALPIGEEYLLVPSSLSDHRPVIELPHCENSEIIIRLYEMPYFPMGFWSRLINRLLEISPYMLSGRERALRPNRMYWRQGIYLNWSPEAYCLVGSEVLDNHPESFLKITVPSCRKGCILLGQVVDHIDSLMEEWFPGLLEIDICGEGETLLKKWALYSFNDGEEHQKILLDDLMKKAEEGDLLVNPDQPRLTIPISQIAPDLILADLPRNIMLNNDELEFEQAPEFLLGDGSFGSVYRAAYEGEEVAVKIFNKHTSLRLLRQELVVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQQDKASLTRTLQHRIALHVADGLRYLHSAMIIYRDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRMGIKTSEGTPGFRAPEVARGNVIYNQQADVYSFGLLLYDILTTGGRIVEGLKFPNEFDELEIQGKLPDPVKEYGCAPWPMVEKLIKQCLKENPQERPTSAQVFDILNSAELVCLTRRILLPKNVIVECMVATHHNSRNASIWLGCGHTDRGQLSFLDLNTEGYTSEEVADSRILCLALVHLPVEKESWIVSGTQSGTLLVINTEDGKKRHTLEKMTDSVTCLYCNSFSKQSKQKNFLLVGTADGKLAIFEDKTVKLKGAAPLKILNIGNVSTPLMCLSESTNSTERNVMWGGCGTKIFSFSNDFTIQKLIETRTSQLFSYAAFSDSNIITVVVDTALYIAKQNSPVVEVWDKKTEKLCGLIDCVHFLREVMVKENKESKHKMSYSGRVKTLCLQKNTALWIGTGGGHILLLDLSTRRLIRVIYNFCNSVRVMMTAQLGSLKNVMLVLGYNRKNTEGTQKQKEIQSCLTVWDINLPHEVQNLEKHIEVRKELAEKMRRTSVE DIP protein Q5S007 original sequence version: 36 DIP protein Q5S007 original sequence version: 68 DIP protein Q5S007 original sequence version: 64 26142A0CECBBC3F4 arhg7_mouse Rho guanine nucleotide exchange factor 7 PAK-interacting exchange factor beta Beta-Pix p85SPR Arhgef7 Pak3bp Kiaa0142 protein protein mouse Mus musculus Mouse MNSAEQTVTWLITLGVLESPKKTISDPEVFLQASLKDGVVLCRLLERLLPGTIEKVYPEPRNESECLSNIREFLRACGASLRLETFDANDLYQGQNFNKVLSSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGSQSSHSRTSKLLQSQYRSLDMTDNTNSQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREIKPSEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETEHEYSKELQSVLSTYLRPLQTSDKLSSANTSYLMGNLEEISSFQQVLVQSLEECTKSPEAQQRVGGCFLSLMPQMRTLYLAYCANHPSAVSVLTEHSEDLGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHPDRQDIQKSMTAFKNLSAQCQEVRKRKELELQILTEPIRSWEGDDIKTLGSVTYMSQVTIQCAGSEEKNERYLLLFPNLLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSENHRNAFEISGSMIERILVSCTSQQDLHEWVEHLQKQTKVTSVSNPTIKPHSVPSHTLPSHPLTPSSKHADSKPVALTPAYHTLPHPSHHGTPHTTISWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFAVRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSTWQGTDLMHNHVLADDDQSSLDSLGRRSSLSRLEPSDLSEDSEYDSIWTAHSYRMGSASRSRKESAPQVLLPEEEKIIVEETKSNGQTVIEEKSLVDTVYALKDEVQELRQDNKKMKKSLEEEQRARKDLEKLVRKVLKNMNDPAWDETNL 46D61B606B8391B4 cdc42_human Cell division control protein 42 homolog CDC42 G25K GTP-binding protein protein protein human Homo sapiens Human MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL 51A437E22A4D8FFF lrrk2_mouse Leucine-rich repeat serine/threonine-protein kinase 2 Lrrk2 protein protein mouse Mus musculus Mouse MASGACQGCEEEEEEEALKKLIVRLNNVQEGKQIETLLQLLEDMLVFTYSDRASKLFEDKNFHVPLLIVLDSYMRVASVQQAGWSLLCKLIEVCPGTLQSLIGPQDIGNDWEVLGIHRLILKMLTVHHANVNLSIVGLKALDLLLDSGKLTLLILDEECDIFLLIFDAMHRYSANDEVQKLGCKALHVLFERVSEEQLTEFVENKDYTILLSTFGSFRRDKEIVYHVLCCLHSLAVTCSNVEVLMSGNVRCYNLVVEAMKAFPTNENIQEVSCSLFQKLTLGNFFNILVLNEVHVFVVKAVRQYPENAALQISALSCLALLTETIFLNQDLEERSETQEQSEEEDSEKLFWLEPCYKALVRHRKDKHVQEAACWALNNLLMYQNSLHEKIGDEDGQFPAHREVMLSMLMHSSSKDVFQAAAHALSTLLEQNVNFRKILLAKGVYLNVLELMQKHAHAPEVAESGCKMLSHLFEGSNPSLDTMAAVVPKILTVMKAHGTSLSVQLEALRAILHFVVPGLLEESREDSQCRPNVLRKQCFRTDIHKLVLVALNRFIGNPGIQKCGLKVISSLAHLPDATETLSLQGAVDSVLHTLQMYPDDQEIQCLGLHLMGCLMTKKNFCIGTGHLLAKILASTLQRFKDVAEVQTTGLQTTLSILELSVSFSKLLVHYSFDVVIFHQMSSSVVEQKDEQFLNLCCKCFAKVAVDDELKNTMLERACDQNNSIMVECLLLLGADANQVKGATSLIYQVCEKESSPKLVELLLNGGCREQDVRKALTVSIQKGDSQVISLLLRKLALDLANNSICLGGFGIGKIDPSWLGPLFPDKSSNLRKQTNTGSVLARKVLRYQMRNTLQEGVASGSDGKFSEDALAKFGEWTFIPDSSMDSVFGQSDDLDSEGSESSFLVKRKSNSISVGEVYRDLALQRCSPNAQRHSNSLGPVFDHEDLLRRKRKILSSDESLRSSRLPSHMRQSDSSSSLASEREHITSLDLSANELKDIDALSQKCCLSSHLEHLTKLELHQNSLTSFPQQLCETLKCLIHLDLHSNKFTSFPSFVLKMPRITNLDASRNDIGPTVVLDPAMKCPSLKQLNLSYNQLSSIPENLAQVVEKLEQLLLEGNKISGICSPLSLKELKILNLSKNHIPSLPGDFLEACSKVESFSARMNFLAAMPALPSSITSLKLSQNSFTCIPEAIFSLPHLRSLDMSHNNIECLPGPAHWKSLNLRELIFSKNQISTLDFSENPHVWSRVEKLHLSHNKLKEIPPEIGCLENLTSLDVSYNLELRSFPNEMGKLSKIWDLPLDGLHLNFDFKHVGCKAKDIIRFLQQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKMKKPELGMQGATVGIDVRDWSIQIRGKRRKDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDEKQRKACISKITKELLNKRGFPTIRDYHFVNATEESDALAKLRKTIINESLNFKIRDQPVVGQLIPDCYVELEKIILSERKAVPTEFPVINRKHLLQLVNEHQLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKVMAQILTVKVDGCLKHPKGIISRRDVEKFLSKKKRFPKNYMMQYFKLLEKFQIALPIGEEYLLVPSSLSDHRPVIELPHCENSEIIIRLYEMPYFPMGFWSRLINRLLEISPFMLSGRERALRPNRMYWRQGIYLNWSPEAYCLVGSEVLDNRPESFLKITVPSCRKGCILLGRVVDHIDSLMEEWFPGLLEIDICGEGETLLKKWALYSFNDGEEHQKILLDELMKKAEEGDLLINPDQPRLTIPISQIAPDLILADLPRNIMLNNDELEFEEAPEFLLGDGSFGSVYRAAYEGEEVAVKIFNKHTSLRLLRQELVVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQQDKASLTRTLQHRIALHVADGLRYLHSAMIIYRDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRMGIKTSEGTPGFRAPEVARGNVIYNQQADVYSFGLLLHDIWTTGSRIMEGLRFPNEFDELAIQGKLPDPVKEYGCAPWPMVEKLITKCLKENPQERPTSAQVFDILNSAELICLMRHILIPKNIIVECMVATNLNSKSATLWLGCGNTEKGQLSLFDLNTERYSYEEVADSRILCLALVHLAAEKESWVVCGTQSGALLVINVEEETKRHTLEKMTDSVTCLHCNSLAKQSKQSNFLLVGTADGNLMIFEDKAVKCKGAAPLKTLHIGDVSTPLMCLSESLNSSERHITWGGCGTKVFSFSNDFTIQKLIETKTNQLFSYAAFSDSNIIALAVDTALYIAKKNSPVVEVWDKKTEKLCELIDCVHFLKEVMVKLNKESKHQLSYSGRVKALCLQKNTALWIGTGGGHILLLDLSTRRVIRTIHNFCDSVRAMATAQLGSLKNVMLVLGYKRKSTEGIQEQKEIQSCLSIWDLNLPHEVQNLEKHIEVRTELADKMRKTSVE DIP protein Q5S006 original sequence version: 57 706E25C173E36F98 arhgef7-lrrk2-1 1 10 unspecified role unspecified role bait bait c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 11 unspecified role unspecified role prey prey c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q5S007:p.Thr1348Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain T N Wed May 02 18:58:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr1348asn' Tue Jun 30 15:45:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr1348Asn' Q5S007:p.Asn1437Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain N S Wed May 02 20:26:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn1437ser' Tue Jun 30 17:46:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn1437Ser' Q5S007:p.Arg1441Cys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain R C Wed May 02 19:48:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg1441cys' Tue Jun 30 18:46:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg1441Cys' roc_cor_kinase_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1A, 4A, S3, 6A, 9A/B arhgef7-lrrk2-2 1 13 unspecified role unspecified role bait bait c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 11 unspecified role unspecified role prey prey c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 1B arhgef7-lrrk2-4 7 11 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component colocalization colocalization 2 cdc42-lrrk2 7 13 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component colocalization colocalization 2 lrrk2-arhgef7 6 14 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association 3A lrrk2-cdc42 6 14 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association 3B lrrk2-arhgef7-2 1 11 unspecified role unspecified role bait bait c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q5S007:p.Arg1441Cys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain R C Wed May 02 16:11:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg1441cys' Tue Jun 30 16:31:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg1441Cys' c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role prey prey c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 4B gtp-lrrk2-11 2 9 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) 11 unspecified role unspecified role prey prey c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q5S007:p.Arg1441Cys mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain R C Wed May 02 16:49:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg1441cys' Tue Jun 30 20:16:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg1441Cys' c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q5S007:p.Thr1348Asn mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain T N Wed May 02 18:57:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr1348asn' Tue Jun 30 15:57:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr1348Asn' roc_cor_kinase_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 10 inhibitor inhibitor unspecified role unspecified role c_terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. physical association physical association 5, 6B/C, 9C Co-expression of ARHGEF7 with WT LRRK2 leads to an induction of LRRK2 protein expression. arhgef7-gtp 3 9 enzyme target enzyme target substrate substrate neutral component neutral component region 33p radiolabel 33p radiolabel P33 33P undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 11 enzyme enzyme neutral component neutral component c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 10 stimulator stimulator neutral component neutral component region strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. gtpase reaction gtpase reaction 7 arhgef7-lrrk2 5 11 enzyme enzyme neutral component neutral component Q5S007:p.Lys1906Met mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain K M Wed May 02 19:37:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys1906met' Tue Jun 30 18:44:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys1906Met' c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 10 enzyme target enzyme target substrate substrate neutral component neutral component n_terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 8A lrrk2-1 5 11 putative self putative self putative self putative self c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q5S007:p.Lys1906Met mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain K M Wed May 02 17:01:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys1906met' Tue Jun 30 17:11:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys1906Met' c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. phosphorylation phosphorylation reaction phosphorylation true 8A arhgef7-gtp-2 4 11 enzyme enzyme neutral component neutral component c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q5S007:p.Lys1906Met mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain K M Wed May 02 18:55:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys1906met' Tue Jun 30 16:09:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys1906Met' c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 10 enzyme target enzyme target substrate substrate neutral component neutral component n_terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) phosphorylation phosphorylation reaction phosphorylation 8B ARHGEF7 phosphorylation by LRRK2 occurs at the threonine residues T107 and T143. gtp-lrrk2-12 2 11 unspecified role unspecified role prey prey roc_cor_kinase_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q5S007:p.Thr1348Asn mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain T N Wed May 02 16:57:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr1348asn' Tue Jun 30 15:59:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr1348Asn' c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range Q5S007:p.Arg1441Cys mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain R C Wed May 02 15:32:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg1441cys' Tue Jun 30 20:10:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg1441Cys' human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 9 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association 5, 6B/C, 9C -2 Co-expression of ARHGEF7 with WT LRRK2 leads to an induction of LRRK2 protein expression. lrrk2-gtp-3 3 9 enzyme target enzyme target substrate substrate neutral component neutral component region 33p radiolabel 33p radiolabel P33 33P undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 11 enzyme enzyme neutral component neutral component c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. gtpase reaction gtpase reaction 7-2