IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Primase directs the release of DnaC from DnaB. Primase directs the release of DnaC from DnaB. Mol. Cell (1097-2765) 2010 imex curation Makowska-Grzyska M., Kaguni J.M. kaguni@msu.edu 01-March-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Makowska-Grzyska M., Kaguni J.M. kaguni@msu.edu Accepted 2013-FEB-07 by ORCHARD 01-March-2013: Contacted by IntAct-Help. Mol. Cell (1097-2765) 2010 Only protein-protein interactions imex curation Primase directs the release of DnaC from DnaB. Primase directs the release of DnaC from DnaB. Mol. Cell (1097-2765) 2010 imex curation Makowska-Grzyska M., Kaguni J.M. kaguni@msu.edu 01-March-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay predetermined predetermined participant predetermined Makowska-Grzyska M., Kaguni J.M. kaguni@msu.edu Accepted 2013-FEB-07 by ORCHARD 01-March-2013: Contacted by IntAct-Help. Mol. Cell (1097-2765) 2010 Only protein-protein interactions imex curation Primase directs the release of DnaC from DnaB. Primase directs the release of DnaC from DnaB. Mol. Cell (1097-2765) 2010 imex curation Makowska-Grzyska M., Kaguni J.M. kaguni@msu.edu 01-March-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Makowska-Grzyska M., Kaguni J.M. kaguni@msu.edu Accepted 2013-FEB-07 by ORCHARD 01-March-2013: Contacted by IntAct-Help. Mol. Cell (1097-2765) 2010 Only protein-protein interactions imex curation Primase directs the release of DnaC from DnaB. Primase directs the release of DnaC from DnaB. Mol. Cell (1097-2765) 2010 imex curation Makowska-Grzyska M., Kaguni J.M. kaguni@msu.edu 01-March-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro comigration in sds comigration in sds page comigration in sds western blot western blot Immuno blot Immuno blot Makowska-Grzyska M., Kaguni J.M. kaguni@msu.edu Accepted 2013-FEB-07 by ORCHARD 01-March-2013: Contacted by IntAct-Help. Mol. Cell (1097-2765) 2010 Only protein-protein interactions imex curation dnab_ecoli Replicative DNA helicase dnaB groP grpA b4052 JW4012 protein protein ecoli Escherichia coli (strain K12) MAGNKPFNKQQAEPRERDPQVAGLKVPPHSIEAEQSVLGGLMLDNERWDDVAERVVADDFYTRPHRHIFTEMARLQESGSPIDLITLAESLERQGQLDSVGGFAYLAELSKNTPSAANISAYADIVRERAVVREMISVANEIAEAGFDPQGRTSEDLLDLAESRVFKIAESRANKDEGPKNIADVLDATVARIEQLFQQPHDGVTGVNTGYDDLNKKTAGLQPSDLIIVAARPSMGKTTFAMNLVENAAMLQDKPVLIFSLEMPSEQIMMRSLASLSRVDQTKIRTGQLDDEDWARISGTMGILLEKRNIYIDDSSGLTPTEVRSRARRIAREHGGIGLIMIDYLQLMRVPALSDNRTLEIAEISRSLKALAKELNVPVVALSQLNRSLEQRADKRPVNSDLRESGSIEQDADLIMFIYRDEVYHENSDLKGIAEIIIGKQRNGPIGTVRLTFNGQWSRFDNYAGPQYDDE 5B5ED3625A7F7DE5 dnaa_ecoli Chromosomal replication initiator protein DnaA dnaA b3702 JW3679 protein protein ecoli Escherichia coli (strain K12) MSLSLWQQCLARLQDELPATEFSMWIRPLQAELSDNTLALYAPNRFVLDWVRDKYLNNINGLLTSFCGADAPQLRFEVGTKPVTQTPQAAVTSNVAAPAQVAQTQPQRAAPSTRSGWDNVPAPAEPTYRSNVNVKHTFDNFVEGKSNQLARAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNGIMARKPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAILMKKADENDIRLPGEVAFFIAKRLRSNVRELEGALNRVIANANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIRTLSS DIP protein P03004 original sequence version: 109 DIP protein P03004 original sequence version: null 607C8366A8CDCCED atp ATP Adenosine 5'-triphosphate Adenosine triphosphate ADENOSINE-5'-TRIPHOSPHATE Adephos Adetol Adynol Atipi ATP Atriphos Cardenosine Fosfobion Glucobasin H4atp Myotriphos Triadenyl Triphosphaden adenosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) dnac_ecoli DNA replication protein DnaC dnaC dnaD b4361 JW4325 protein protein ecoli Escherichia coli (strain K12) MKNVGDLMQRLQKMMPAHIKPAFKTGEELLAWQKEQGAIRSAALERENRAMKMQRTFNRSGIRPLHQNCSFENYRVECEGQMNALSKARQYVEEFDGNIASFIFSGKPGTGKNHLAAAICNELLLRGKSVLIITVADIMSAMKDTFRNSGTSEEQLLNDLSNVDLLVIDEIGVQTESKYEKVIINQIVDRRSSSKRPTGMLTNSNMEEMTKLLGERVMDRMRLGNSLWVIFNWDSYRSRVTGKEY DIP protein P0AEF0 original sequence version: 80 DIP protein P0AEF0 original sequence version: null C5CC7232E21F11F1 ssdna single-stranded dna ss dna single stranded deoxyribonucleic acid ss DNA ss dna chemical synthesis Chemical synthesis (Chemical synthesis) CATCCAATAAATCATACACAAGGC m13oric2lb5 M13oriC2LB5 supercoiled DNA plasmid containing E.coli replication origin dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid chemical synthesis Chemical synthesis (Chemical synthesis) dnac-atp 1 7 unspecified role unspecified role unspecified role unspecified role region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 8 unspecified role unspecified role unspecified role unspecified role ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2a dnab-dnac-1 2 5 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey P0AEF0:p.Leu11Gln mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L Q Wed May 02 19:50:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu11gln' Tue Jun 30 19:47:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu11Gln' ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2b, c dnac-ssdna-atp 3 8 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role bait bait 5-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 3 ssdna-dnac 3 8 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait 5-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Fig. 3 dnaa-dnab-dnac 4 10 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 6 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association Fig. 5, 6 Stoichiometry of DnaA, DnaB and DnaC (wildtype) calculated relative to one copy of the oriC plasmid in an assay containing M13oriC2LB5, DnaA, DnaB, DnaC, HU, SSB and ATP/ATPgammaS. Stoichiometry changes slightly depending on which prepriming and replication complex enzymes were added to the assay (Fig. 6). Binding of DnaC lost if DnaG (primase) and rNTPs added.