IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Lrrk2 phosphorylates alpha synuclein at serine 129: Parkinson disease implications. Lrrk2 phosphorylates alpha synuclein at serine 129: Parkinson disease implications. Biochem. Biophys. Res. Commun. (0006-291X) 2009 imex curation Qing H., Wong W., McGeer E.G., McGeer P.L. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease This assay does not fulfil our usual purification criteria (there is not even an IP) - but the absence of a band for the empty vector hek293 lysate would (to my mind) enable us to include these results. (?) Especially as this is a potentially important reaction - not covered much elsewhere as far as I am aware. (I may have curated this interaction once, but there is nothing in the public database currently.) SNCA phosphorylation was detected by use of an antibody specific for SNCA phosphorylated at serine 129.(Epitomics-EP1536Y). HEK cell lysate produced from cells that had been transfected with an empty vector only, showed no bands on blots. mcgeerpl@interchange.ubc.ca 01-March-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay western blot western blot Immuno blot Immuno blot Qing H., Wong W., McGeer E.G., McGeer P.L. Parkinsons - Interactions investigated in the context of Parkinsons disease This assay does not fulfil our usual purification criteria (there is not even an IP) - but the absence of a band for the empty vector hek293 lysate would (to my mind) enable us to include these results. (?) Especially as this is a potentially important reaction - not covered much elsewhere as far as I am aware. (I may have curated this interaction once, but there is nothing in the public database currently.) SNCA phosphorylation was detected by use of an antibody specific for SNCA phosphorylated at serine 129.(Epitomics-EP1536Y). HEK cell lysate produced from cells that had been transfected with an empty vector only, showed no bands on blots. mcgeerpl@interchange.ubc.ca Accepted 2013-FEB-22 by ORCHARD 01-March-2013: Contacted by IntAct-Help. Biochem. Biophys. Res. Commun. (0006-291X) 2009 Only protein-protein interactions imex curation syua_human Alpha-synuclein Non-A beta component of AD amyloid Non-A4 component of amyloid precursor SNCA NACP PARK1 protein protein human Homo sapiens Human MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA DIP protein P37840 original sequence version: 124 DIP protein P37840 original sequence version: 175 DIP protein P37840 original sequence version: 178 6BB2F12128931663 csk21_human Casein kinase II subunit alpha CSNK2A1 CK2A1 protein protein human Homo sapiens Human MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSANMMSGISSVPTPSPLGPLAGSPVIAAANPLGMPVPAAAGAQQ DIP protein P68400 original sequence version: 88 DIP protein P68400 original sequence version: 78 DIP protein P68400 original sequence version: 100 DIP protein P68400 original sequence version: 110 DIP protein P68400 original sequence version: 125 DIP protein P68400 original sequence version: 136 D3B6F5D13FF7422D csk21-snca 1 2 enzyme target enzyme target substrate substrate neutral component neutral component ecoli Escherichia coli (strain K12) 3 enzyme enzyme neutral component neutral component n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection phosphorylation phosphorylation reaction phosphorylation 1B-2/C/D alpha synuclein was phosphorylated at serine 129.