IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Cytosolic Aryl sulfotransferase 4A1 interacts with the peptidyl prolyl cis-trans isomerase Pin1. Cytosolic Aryl sulfotransferase 4A1 interacts with the peptidyl prolyl cis-trans isomerase Pin1. Mol. Pharmacol. (0026-895X) 2009 imex curation Mitchell D.J., Minchin R.F. d.mitchell@uq.edu.au 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Mitchell D.J., Minchin R.F. d.mitchell@uq.edu.au Accepted 2013-JUN-04 by ORCHARD 17-Jun-2013: Contacted by IntAct-Help. Mol. Pharmacol. (0026-895X) 2009 Only protein-protein interactions imex curation Cytosolic Aryl sulfotransferase 4A1 interacts with the peptidyl prolyl cis-trans isomerase Pin1. Cytosolic Aryl sulfotransferase 4A1 interacts with the peptidyl prolyl cis-trans isomerase Pin1. Mol. Pharmacol. (0026-895X) 2009 imex curation Mitchell D.J., Minchin R.F. d.mitchell@uq.edu.au 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Mitchell D.J., Minchin R.F. d.mitchell@uq.edu.au Accepted 2013-JUN-04 by ORCHARD 17-Jun-2013: Contacted by IntAct-Help. Mol. Pharmacol. (0026-895X) 2009 Only protein-protein interactions imex curation Cytosolic Aryl sulfotransferase 4A1 interacts with the peptidyl prolyl cis-trans isomerase Pin1. Cytosolic Aryl sulfotransferase 4A1 interacts with the peptidyl prolyl cis-trans isomerase Pin1. Mol. Pharmacol. (0026-895X) 2009 imex curation Mitchell D.J., Minchin R.F. d.mitchell@uq.edu.au 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Mitchell D.J., Minchin R.F. d.mitchell@uq.edu.au Accepted 2013-JUN-04 by ORCHARD 17-Jun-2013: Contacted by IntAct-Help. Mol. Pharmacol. (0026-895X) 2009 Only protein-protein interactions imex curation Cytosolic Aryl sulfotransferase 4A1 interacts with the peptidyl prolyl cis-trans isomerase Pin1. Cytosolic Aryl sulfotransferase 4A1 interacts with the peptidyl prolyl cis-trans isomerase Pin1. Mol. Pharmacol. (0026-895X) 2009 imex curation Mitchell D.J., Minchin R.F. d.mitchell@uq.edu.au 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Mitchell D.J., Minchin R.F. d.mitchell@uq.edu.au Accepted 2013-JUN-04 by ORCHARD 17-Jun-2013: Contacted by IntAct-Help. Human brain cDNA library Mol. Pharmacol. (0026-895X) 2009 Only protein-protein interactions imex curation st4a1_human Sulfotransferase 4A1 SULT4A1 SULTX3 Brain sulfotransferase-like protein Nervous system sulfotransferase protein protein human Homo sapiens Human MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVRPSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKELTSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLRTMSYRGTFQEFCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLKYEDMHRDLVTMVEQLARFLGVSCDKAQLEALTEHCHQLVDQCCNAEALPVGRGRVGLWKDIFTVSMNEKFDLVYKQKMGKCDLTFDFYL A6EA6844B66C400B pin1_human Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 Rotamase Pin1 Peptidyl-prolyl cis-trans isomerase Pin1 PIN1 protein protein human Homo sapiens Human MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE DIP protein Q13526 original sequence version: 65 DIP protein Q13526 original sequence version: 64 DIP protein Q13526 original sequence version: 163 DIP protein Q13526 original sequence version: 156 DIP protein Q13526 original sequence version: 117 35391AF40B7D1E13 sult4a1-pin1 2 6 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9BR01:p.Thr8Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A Wed May 02 17:56:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr8ala' Tue Jun 30 19:24:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr8Ala' Q9BR01:p.Thr11Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T A Wed May 02 17:09:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr11ala' Tue Jun 30 16:34:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr11Ala' physical association physical association Fig. 1a, Fig. 1c, Fig. 4b This interaction is inhibited when cell lysate is treated with calf intestinal alkaline phosphatase (CIP) (20 U/ml). pin1-sult4a1 3 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecobd Escherichia coli (strain B / BL21-DE3) 5 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 physical association physical association Fig. 1b sult4a1-pin1-1 4 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Text - Materials and Methods / Results pin1-sult4a1-1 1 6 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association Text - Materials and Methods / Results sult4a1-sult4a1 4 5 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association Text - Materials and Methods / Results