UniProt UniProt http://www.uniprot.org Kaposi's sarcoma-associated herpesvirus K7 induces viral G protein-coupled receptor degradation and reduces its tumorigenicity. Kaposi's sarcoma-associated herpesvirus K7 induces viral G protein-coupled receptor degradation and reduces its tumorigenicity. PLoS Pathog. (1553-7366) 2008 imex curation Feng H., Dong X., Negaard A., Feng P. Viral proteins have been mapped to the UniProt HHV-8 reference strain Pinghui.Feng@UTSouthwestern.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy anti-tag immunocytochemistry anti-tag immunocytochemistry Feng H., Dong X., Negaard A., Feng P. Viral proteins have been mapped to the UniProt HHV-8 reference strain Pinghui.Feng@UTSouthwestern.edu Accepted 2014-JAN-07 by MGT PLoS Pathog. (1553-7366) 2008 imex curation Kaposi's sarcoma-associated herpesvirus K7 induces viral G protein-coupled receptor degradation and reduces its tumorigenicity. Kaposi's sarcoma-associated herpesvirus K7 induces viral G protein-coupled receptor degradation and reduces its tumorigenicity. PLoS Pathog. (1553-7366) 2008 imex curation Feng H., Dong X., Negaard A., Feng P. Viral proteins have been mapped to the UniProt HHV-8 reference strain Pinghui.Feng@UTSouthwestern.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Feng H., Dong X., Negaard A., Feng P. Viral proteins have been mapped to the UniProt HHV-8 reference strain Pinghui.Feng@UTSouthwestern.edu Accepted 2014-JAN-07 by MGT PLoS Pathog. (1553-7366) 2008 imex curation Kaposi's sarcoma-associated herpesvirus K7 induces viral G protein-coupled receptor degradation and reduces its tumorigenicity. Kaposi's sarcoma-associated herpesvirus K7 induces viral G protein-coupled receptor degradation and reduces its tumorigenicity. PLoS Pathog. (1553-7366) 2008 imex curation Feng H., Dong X., Negaard A., Feng P. Viral proteins have been mapped to the UniProt HHV-8 reference strain Pinghui.Feng@UTSouthwestern.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions human-bjab Homo sapiens B-cell lymphoma cell line bjab B-cell lymphoma cell line, derived from the tumour of an exceptional African case of Burkitt's lymphoma confocal microscopy confocal microscopy anti-tag immunocytochemistry anti-tag immunocytochemistry Feng H., Dong X., Negaard A., Feng P. Viral proteins have been mapped to the UniProt HHV-8 reference strain Pinghui.Feng@UTSouthwestern.edu Accepted 2014-JAN-07 by MGT PLoS Pathog. (1553-7366) 2008 imex curation k7_hhv8p Protein K7 K7 protein protein hhv8p Human herpesvirus 8 Kaposi's sarcoma-associated herpesvirus HHV-8 MGTLEIKGASLSQFSTGTAQSPWLPLHLWILCSLLAFLPLLVFIGAADCGLIASLLAIYPSWLSARFSVLLFPHWPESCSTKNTARSGALHKPAEQKLRFAQKPCHGNYTVTPCGLLHWIQSPGQL 189A7D9FCEDD91E3 vgpcr_hhv8p viral G-protein coupled receptor ORF74 Protein ORF74 protein protein hhv8p Human herpesvirus 8 Kaposi's sarcoma-associated herpesvirus HHV-8 MAAEDFLTIFLDDDESWNETLNMSGYDYSGNFSLEVSVCEMTTVVPYTWNVGILSLIFLINVLGNGLVTYIFCKHRSRAGAIDILLLGICLNSLCLSISLLAEVLMFLFPNIISTGLCRLEIFFYYLYVYLDIFSVVCVSLVRYLLVAYSTRSWPKKQSLGWVLTSAALLIALVLSGDACRHRSRVVDPVSKQAMCYENAGNMTADWRLHVRTVSVTAGFLLPLALLILFYALTWCVVRRTKLQARRKVRGVIVAVVLLFFVFCFPYHVLNLLDTLLRRRWIRDSCYTRGLINVGLAVTSLLQALYSAVVPLIYSCLGSLFRQRMYGLFQSLRQSFMSGATT mint 41E4B33CA2D9F069 k7-orf74 2 5 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 4 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1A, B k7-orf74-1 2 5 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 4 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1A and C k7-orf74-3 1 5 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 4 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2C k7-orf74-4 3 5 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 4 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2C orf74-k7 2 5 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 4 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 1D