bhf-ucl The postsynaptic density 95/disc-large/zona occludens protein syntenin directly interacts with frizzled 7 and supports noncanonical Wnt signaling. The postsynaptic density 95/disc-large/zona occludens protein syntenin directly interacts with frizzled 7 and supports noncanonical Wnt signaling. Mol. Biol. Cell (1059-1524) 2008 imex curation Luyten A., Mortier E., Van Campenhout C., Taelman V., Degeest G., Wuytens G., Lambaerts K., David G., Bellefroid E.J., Zimmermann P. It is not specified what kind of antibody was used to detect GST-myc-syntenin pascale.zimmermann@med.kuleuven.be 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Luyten A., Mortier E., Van Campenhout C., Taelman V., Degeest G., Wuytens G., Lambaerts K., David G., Bellefroid E.J., Zimmermann P. It is not specified what kind of antibody was used to detect GST-myc-syntenin pascale.zimmermann@med.kuleuven.be Accepted 2013-AUG-14 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. Mol. Biol. Cell (1059-1524) 2008 imex curation The postsynaptic density 95/disc-large/zona occludens protein syntenin directly interacts with frizzled 7 and supports noncanonical Wnt signaling. The postsynaptic density 95/disc-large/zona occludens protein syntenin directly interacts with frizzled 7 and supports noncanonical Wnt signaling. Mol. Biol. Cell (1059-1524) 2008 imex curation Luyten A., Mortier E., Van Campenhout C., Taelman V., Degeest G., Wuytens G., Lambaerts K., David G., Bellefroid E.J., Zimmermann P. It is not specified what kind of antibody was used to detect GST-myc-syntenin pascale.zimmermann@med.kuleuven.be 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Luyten A., Mortier E., Van Campenhout C., Taelman V., Degeest G., Wuytens G., Lambaerts K., David G., Bellefroid E.J., Zimmermann P. It is not specified what kind of antibody was used to detect GST-myc-syntenin pascale.zimmermann@med.kuleuven.be Accepted 2013-AUG-14 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. Mol. Biol. Cell (1059-1524) 2008 imex curation The postsynaptic density 95/disc-large/zona occludens protein syntenin directly interacts with frizzled 7 and supports noncanonical Wnt signaling. The postsynaptic density 95/disc-large/zona occludens protein syntenin directly interacts with frizzled 7 and supports noncanonical Wnt signaling. Mol. Biol. Cell (1059-1524) 2008 imex curation Luyten A., Mortier E., Van Campenhout C., Taelman V., Degeest G., Wuytens G., Lambaerts K., David G., Bellefroid E.J., Zimmermann P. It is not specified what kind of antibody was used to detect GST-myc-syntenin pascale.zimmermann@med.kuleuven.be 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Luyten A., Mortier E., Van Campenhout C., Taelman V., Degeest G., Wuytens G., Lambaerts K., David G., Bellefroid E.J., Zimmermann P. It is not specified what kind of antibody was used to detect GST-myc-syntenin pascale.zimmermann@med.kuleuven.be Accepted 2013-AUG-14 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. Mol. Biol. Cell (1059-1524) 2008 imex curation The postsynaptic density 95/disc-large/zona occludens protein syntenin directly interacts with frizzled 7 and supports noncanonical Wnt signaling. The postsynaptic density 95/disc-large/zona occludens protein syntenin directly interacts with frizzled 7 and supports noncanonical Wnt signaling. Mol. Biol. Cell (1059-1524) 2008 imex curation Luyten A., Mortier E., Van Campenhout C., Taelman V., Degeest G., Wuytens G., Lambaerts K., David G., Bellefroid E.J., Zimmermann P. It is not specified what kind of antibody was used to detect GST-myc-syntenin pascale.zimmermann@med.kuleuven.be 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Luyten A., Mortier E., Van Campenhout C., Taelman V., Degeest G., Wuytens G., Lambaerts K., David G., Bellefroid E.J., Zimmermann P. It is not specified what kind of antibody was used to detect GST-myc-syntenin pascale.zimmermann@med.kuleuven.be Accepted 2013-AUG-14 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. They used the MCF-7 cell line Mol. Biol. Cell (1059-1524) 2008 imex curation The postsynaptic density 95/disc-large/zona occludens protein syntenin directly interacts with frizzled 7 and supports noncanonical Wnt signaling. The postsynaptic density 95/disc-large/zona occludens protein syntenin directly interacts with frizzled 7 and supports noncanonical Wnt signaling. Mol. Biol. Cell (1059-1524) 2008 imex curation Luyten A., Mortier E., Van Campenhout C., Taelman V., Degeest G., Wuytens G., Lambaerts K., David G., Bellefroid E.J., Zimmermann P. It is not specified what kind of antibody was used to detect GST-myc-syntenin pascale.zimmermann@med.kuleuven.be 09-Sep-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting western blot western blot Immuno blot Immuno blot Luyten A., Mortier E., Van Campenhout C., Taelman V., Degeest G., Wuytens G., Lambaerts K., David G., Bellefroid E.J., Zimmermann P. It is not specified what kind of antibody was used to detect GST-myc-syntenin pascale.zimmermann@med.kuleuven.be Accepted 2013-AUG-14 by ORCHARD 09-Sep-2013: Contacted by IntAct-Help. Mol. Biol. Cell (1059-1524) 2008 imex curation sdc2_human Syndecan-2 SDC2 HSPG1 Fibroglycan Heparan sulfate proteoglycan core protein protein protein human Homo sapiens Human MRRAWILLTLGLVACVSAESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYDLGERKPSSAAYQKAPTKEFYA DIP protein P34741 original sequence version: 74 DIP protein P34741 original sequence version: 119 DIP protein P34741 original sequence version: 102 7DA4159D54741054 sdcb1_human Syntenin-1 Scaffold protein Pbp1 Pro-TGF-alpha cytoplasmic domain-interacting protein 18 Syndecan-binding protein 1 Melanoma differentiation-associated protein 9 SDCBP MDA9 SYCL protein protein human Homo sapiens Human MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV DIP protein O00560 original sequence version: 87 DIP protein O00560-1 original sequence version: 117 574E1349F86F949F q7zym5_xenla sdcbp.S sdcbp protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSLYPSLEDLKVDKVIQAQTTFSANPVNAAILPSASVSTAQYGGMYPKLYPELEQYMGLSLSEDEIHRNMSVVPSAGNQVAVPTALNNMVAPVSGSDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQVNSPASLAGLKFGDQILQINGENCAGWSSDKSHKMLKQVSGERISMVVRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTDHNLCEINGQNVIGLKDSQVAEILATSANVVTLTVMPSFIFDHMVKRMASSVLKSLMDHSVPEV 14717B8CAA23184B fzd7_human Frizzled-7 FzE3 FZD7 protein protein human Homo sapiens Human MRDPGAAAPLSSLGLCALVLALLGALSAGAGAQPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTALPPGASDGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVAHVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV 801934246B426DF5 fzd3_human Frizzled-3 FZD3 protein protein human Homo sapiens Human MAMTWIVFSLWPLTVFMGHIGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAALAMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFLHVRDCSPPCPNMYFRREELSFARYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIFYAVCYMMVSLIFFIGFLLEDRVACNASIPAQYKASTVTQGSHNKACTMLFMILYFFTMAGSVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGVCFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIRIGVFSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQVTQMSRPDLILFLMKYLMALIVGIPSVFWVGSKKTCFEWASFFHGRRKKEIVNESRQVLQEPDFAQSLLRDPNTPIIRKSRGTSTQGTSTHASSTQLAMVDDQRSKAGSIHSKVSSYHGSLHRSRDGRYTPCSYRGMEERLPHGSMSRLTDHSRHSSSHRLNEQSRHSSIRDLSNNPMTHITHGTSMNRVIEEDGTSA 46D7C46E21160215 fzd8_human Frizzled-8 FZD8 protein protein human Homo sapiens Human MEWGYLLEVTSLLAALALLQRSSGAAAASAKELACQEITVPLCKGIGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSPPRRLPPPPPGEQPPSGSGHGRPPGARPPHRGGGRGGGGGDAAAPPARGGGGGGKARPPGGGAAPCEPGCQCRAPMVSVSSERHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFWIGLWSVLCFVSTFATVSTFLIDMERFKYPERPIIFLSACYLFVSVGYLVRLVAGHEKVACSGGAPGAGGAGGAGGAAAGAGAAGAGAGGPGGRGEYEELGAVEQHVRYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQDGPTKTHKLEKLMIRLGLFTVLYTVPAAVVVACLFYEQHNRPRWEATHNCPCLRDLQPDQARRPDYAVFMLKYFMCLVVGITSGVWVWSGKTLESWRSLCTRCCWASKGAAVGGGAGATAAGGGGGPGGGGGGGPGGGGGPGGGGGSLYSDVSTGLTWRSGTASSVSYPKQMPLSQV E740CBFDA2A233EF fzd7a_xenla Frizzled-7-A fzd7-a fz7-a protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSSTVSLLFCCLFLQLCPSAQQYHGEKGISVPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDNSPSGPTARPSPYLPDSITFQPHPHRDFTCPRQLKVPPYLAYRFLGEKDCGAPCEPGKANGLMYFKEEEVRFARLWVGIWAILCCISTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVAYTAGFLLEERAVCVERFSEDSYRTVAQGTKKEGCTILFMILYFFGMASSIWWVILSLTWFLSAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDVLSGVCYVGINSVDSLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVMYTVPATIVLACYFYEQAFRDTWEKTWLVQTCKGYAVPCPNYNFAPMSPDFTVFMIKYLMTMIVGITSSFWIWSGKTLQSWRRFYHRLSNGSKGETAV DA44954BFF8F594B sdcbp-fzd3 2 7 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range pdz2 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range pdz1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey c-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range cytoplasmic domain binding region binding-associated region binding region predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 1B, 1C sdcbp-fzd8 2 7 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range pdz1 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain pdz2 sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 'Sufficient to bind' with a question mark..The band here is very faint. Is this correct? ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey cytoplasmic domain binding region binding-associated region binding region predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain c-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 1B, 1C sdcbp-fzd7-3 2 7 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range pdz1 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey cytoplasmic domain binding region binding-associated region binding region predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain O75084:p.Val574Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain V A Wed May 02 19:08:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val574ala' Tue Jun 30 16:08:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val574Ala' c-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range O75084:p.Thr572Ala mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain T A Wed May 02 15:11:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr572ala' Tue Jun 30 18:25:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr572Ala' O75084:p.[Thr572Ala;Val574Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain V A Wed May 02 15:49:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr572ala,val574ala' Tue Jun 30 16:06:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr572Ala;Val574Ala]' ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 1B, C sdcbp-sdc2 2 7 unspecified role unspecified role bait bait pdz2 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain pdz1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role prey prey tyr_ala200-201del_del mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain YA .. Wed Jul 06 16:38:13 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'tyr200_ala201' c-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 1B, 1C sdcbp-fzd7-4 1 9 unspecified role unspecified role prey prey cytoplasmic domain binding region binding-associated region binding region predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain c-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range pdz1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 1D sdcbp-fzd7-5 4 7 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey cytoplasmic domain binding region binding-associated region binding region predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain n-terminal eyfp enhanced yellow fluorescent protein tag eyfp n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 1E fzd7-sdcbp 3 9 unspecified role unspecified role neutral component neutral component O75084:p.Thr572Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain T A Wed May 02 16:53:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr572ala' Tue Jun 30 19:55:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr572Ala' 7 unspecified role unspecified role neutral component neutral component egfp tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig.2 A, B, C sdcbp-fzd7_a 5 8 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction Fig. 4J sdcbp-fzd7-1 5 8 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey O75084:p.Thr572Ala mutation disrupting mutation disrupting interaction mutation disrupting predetermined featur predetermined feature predetermined featur certain certain sequence position certain certain certain sequence position certain T A Wed May 02 18:37:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr572ala' Tue Jun 30 16:37:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr572Ala' cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction Fig. 4J