UniProt UniProt http://www.uniprot.org S100B and S100A6 differentially modulate cell survival by interacting with distinct RAGE (receptor for advanced glycation end products) immunoglobulin domains. S100B and S100A6 differentially modulate cell survival by interacting with distinct RAGE (receptor for advanced glycation end products) immunoglobulin domains. J. Biol. Chem. (0021-9258) 2007 mimix curation Leclerc E., Fritz G., Weibel M., Heizmann C.W., Galichet A. arnaud.galichet@kispi.uzh.ch 04-Feb-2013: Contacted by IntAct-Help. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Leclerc E., Fritz G., Weibel M., Heizmann C.W., Galichet A. arnaud.galichet@kispi.uzh.ch Accepted 2013-JAN-24 by PPORRAS 04-Feb-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2007 mimix curation rage_human Advanced glycosylation end product-specific receptor AGER RAGE Receptor for advanced glycosylation end products protein protein human Homo sapiens Human MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALALGILGGLGTAALLIGVILWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP DIP protein Q15109 original sequence version: 157 0D584C436C30CCE7 s10a1_human Protein S100-A1 S100 calcium-binding protein A1 S-100 protein subunit alpha S-100 protein alpha chain S100A1 S100A protein protein human Homo sapiens Human MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS AD5E53AF326B25D2 s100b_human Protein S100-B S100B S100 calcium-binding protein B S-100 protein subunit beta S-100 protein beta chain protein protein human Homo sapiens Human MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE 43815AC212A3AD6B ager-s100a1 1 3 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait Soluble AGER (sRAGE) has been used. sRAGE is procuced by proteolytic cleavage and/or alternative splicing and cannot be mapped to a UniProt AcNo. direct interaction direct interaction 1 ager-s100b 1 4 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait Soluble AGER (sRAGE) has been used. sRAGE is procuced by proteolytic cleavage and/or alternative splicing and cannot be mapped to a UniProt AcNo. direct interaction direct interaction 1