NTNU NTNU, Norwegian University of Science and Technology www.ntnu.no/home ESE-3 transcription factor is involved in the expression of death receptor (DR)-5 through putative Ets sites. ESE-3 transcription factor is involved in the expression of death receptor (DR)-5 through putative Ets sites. Biochem. Biophys. Res. Commun. (0006-291X) 2006 imex curation Lim J.H., Cho J.Y., Park Y.B., Park J.W., Kwon T.K. Authors do not state species of their Ets cDNA in expression vectors used. However, they state that the source of the expression constructs is Towia Libermann, Harvard Medical School. Based on his paper PMID: 10644770, curator believes that the Ets-factor EHF annotated here is human kwontk@dsmc.or.kr 14-Oct-2013: Contacted by IntAct-Help. in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa autoradiography autoradiography Lim J.H., Cho J.Y., Park Y.B., Park J.W., Kwon T.K. Authors do not state species of their Ets cDNA in expression vectors used. However, they state that the source of the expression constructs is Towia Libermann, Harvard Medical School. Based on his paper PMID: 10644770, curator believes that the Ets-factor EHF annotated here is human kwontk@dsmc.or.kr Accepted 2013-OCT-07 by ORCHARD 14-Oct-2013: Contacted by IntAct-Help. Biochem. Biophys. Res. Commun. (0006-291X) 2006 imex curation ehf_human ETS homologous factor ETS domain-containing transcription factor Epithelium-specific Ets transcription factor 3 EHF ESE3B ESEJ ESE3 protein protein human Homo sapiens Human MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQHLLDTNQLDANCIPFQEFDINGEHLCSMSLQEFTRAAGTAGQLLYSNLQHLKWNGQCSSDLFQSTHNVIVKTEQTEPSIMNTWKDENYLYDTNYGSTVDLLDSKTFCRAQISMTTTSHLPVAESPDMKKEQDPPAKCHTKKHNPRGTHLWEFIRDILLNPDKNPGLIKWEDRSEGVFRFLKSEAVAQLWGKKKNNSSMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNARGWRENEN 5CABB38BAF852ED0 tnfrsf10b_human_dna TNFRSF1B tumor necrosis factor receptor superfamily, member 1B ds dna double stranded deoxyribonucleic acid ds DNA ds dna human Homo sapiens Human GAGAAAGGAAGGAAAGAGAAAGCA tnfrsf10b-ehf 1 3 competitor competitor competitor prey prey a9t_alias_m4 mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain a10t_alias_m5 mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain a14t_alias_m2 mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 2 unspecified role unspecified role prey prey gst-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig 3 tnfrsf10b-ehf-1 1 3 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 2 unspecified role unspecified role prey prey gst-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig 3