IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Detection of protein-protein interactions in the alkanesulfonate monooxygenase system from Escherichia coli. Detection of protein-protein interactions in the alkanesulfonate monooxygenase system from Escherichia coli. J. Bacteriol. (0021-9193) 2006 imex curation Abdurachim K., Ellis H.R. ellishr@auburn.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Abdurachim K., Ellis H.R. FMN was first bound to SsuE before it was titrated with SsuD. ellishr@auburn.edu Accepted 2013-NOV-21 by PPORRAS J. Bacteriol. (0021-9193) 2006 Only protein-protein interactions imex curation Detection of protein-protein interactions in the alkanesulfonate monooxygenase system from Escherichia coli. Detection of protein-protein interactions in the alkanesulfonate monooxygenase system from Escherichia coli. J. Bacteriol. (0021-9193) 2006 imex curation Abdurachim K., Ellis H.R. ellishr@auburn.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Abdurachim K., Ellis H.R. ellishr@auburn.edu Accepted 2013-NOV-21 by PPORRAS J. Bacteriol. (0021-9193) 2006 Only protein-protein interactions imex curation Detection of protein-protein interactions in the alkanesulfonate monooxygenase system from Escherichia coli. Detection of protein-protein interactions in the alkanesulfonate monooxygenase system from Escherichia coli. J. Bacteriol. (0021-9193) 2006 imex curation Abdurachim K., Ellis H.R. ellishr@auburn.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro cd circular dichroism CD CD cd predetermined predetermined participant predetermined Abdurachim K., Ellis H.R. ellishr@auburn.edu Accepted 2013-NOV-21 by PPORRAS J. Bacteriol. (0021-9193) 2006 Only protein-protein interactions imex curation Detection of protein-protein interactions in the alkanesulfonate monooxygenase system from Escherichia coli. Detection of protein-protein interactions in the alkanesulfonate monooxygenase system from Escherichia coli. J. Bacteriol. (0021-9193) 2006 imex curation Abdurachim K., Ellis H.R. ellishr@auburn.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Abdurachim K., Ellis H.R. I'm not happy with this experiment as the crucial 63 kD band is rather hard to distinguish and there are no markers on Figure 5b to clarify which band is supposed to be which. It is also not entirely clear to me what the 'native' proteins are. Also, not all the controls are in Figure 5b. Lane 3 is probably the crosslinked SsuE but the SsuE plus BSA is not shown. Crosslinking agent is ProFound Label Transfer Sulfo-SBED {sulfosuccinimidyl[2,6-(biotinamido)-2-(p-azidobenzamido)-hexanoamido]-ethyl-1,3′-dithiopropionate} Protein:Protein Interaction Agent (Pierce, Rockford, IL). ellishr@auburn.edu Accepted 2013-NOV-21 by PPORRAS J. Bacteriol. (0021-9193) 2006 Only protein-protein interactions imex curation ssud_ecoli Alkanesulfonate monooxygenase Sulfate starvation-induced protein 6 ycbN FMNH2-dependent aliphatic sulfonate monooxygenase ssuD b0935 JW0918 protein protein ecoli Escherichia coli (strain K12) MSLNMFWFLPTHGDGHYLGTEEGSRPVDHGYLQQIAQAADRLGYTGVLIPTGRSCEDAWLVAASMIPVTQRLKFLVALRPSVTSPTVAARQAATLDRLSNGRALFNLVTGSDPQELAGDGVFLDHSERYEASAEFTQVWRRLLQRETVDFNGKHIHVRGAKLLFPAIQQPYPPLYFGGSSDVAQELAAEQVDLYLTWGEPPELVKEKIEQVRAKAAAHGRKIRFGIRLHVIVRETNDEAWQAAERLISHLDDETIAKAQAAFARTDSVGQQRMAALHNGKRDNLEISPNLWAGVGLVRGGAGTALVGDGPTVAARINEYAALGIDSFVLSGYPHLEEAYRVGELLFPLLDVAIPEIPQPQPLNPQGEAVANDFIPRKVAQS DIP protein P80645 original sequence version: 86 DIP protein P80645 original sequence version: null 4D05E510487999C6 fmn FMN 1-deoxy-1-(7,8-dimethyl-2,4-dioxo-3,4-dihydrobenzo[g]pteridin-10(2H)-yl)-5-O-phosphono-D-ribitol Flavin mononucleotide FLAVIN MONONUCLEOTIDE FMN riboflavin 5'-(dihydrogen phosphate) riboflavin 5'-monophosphate riboflavin 5'-phosphate riboflavin monophosphate Riboflavin-5-phosphate riboflavine dihydrogen phosphate 1-deoxy-1-(7,8-dimethyl-2,4-dioxo-3,4-dihydrobenzo[g]pteridin-10(2H)-yl)-5-O-phosphono-D-ribitol small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) FVTCRASFADXXNN-SCRDCRAPSA-N FVTCRASFADXXNN-SCRDCRAPSA-N ssue_ecoli FMN reductase (NADPH) ycbP Sulfate starvation-induced protein 4 ssuE b0937 JW0920 FMN reductase protein protein ecoli Escherichia coli (strain K12) MRVITLAGSPRFPSRSSSLLEYAREKLNGLDVEVYHWNLQNFAPEDLLYARFDSPALKTFTEQLQQADGLIVATPVYKAAYSGALKTLLDLLPERALQGKVVLPLATGGTVAHLLAVDYALKPVLSALKAQEILHGVFADDSQVIDYHHRPQFTPNLQTRLDTALETFWQALHRRDVQVPDLLSLRGNAHA 2371808C97CEE532 ssud-ssue-1 2 5 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2 ssud-ssue-2 3 6 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 4 The SsuD-His construct was not added as a participant because the spectrum did not change significantly when SsuD-His was added to the reaction. ssud-ssue-3 4 5 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 5b ssud-ssue-4 1 5 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Fig.s 6, 7