bhf-ucl Caveolin is necessary for Wnt-3a-dependent internalization of LRP6 and accumulation of beta-catenin. Caveolin is necessary for Wnt-3a-dependent internalization of LRP6 and accumulation of beta-catenin. Dev. Cell (1534-5807) 2006 imex curation Yamamoto H., Komekado H., Kikuchi A. Cardiac - Interactions involving cardiac related proteins The authors have confirmed the species for Axin (rat), Fz5 (mouse) and GSK-3beta (human). hyamamoto@molbiobc.med.osaka-u.ac.jp, akikuchi@hiroshima-u.ac.jp 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Yamamoto H., Komekado H., Kikuchi A. Cardiac - Interactions involving cardiac related proteins The authors have confirmed the species for Axin (rat), Fz5 (mouse) and GSK-3beta (human). hyamamoto@molbiobc.med.osaka-u.ac.jp, akikuchi@hiroshima-u.ac.jp Accepted 2013-SEP-23 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. Dev. Cell (1534-5807) 2006 imex curation Caveolin is necessary for Wnt-3a-dependent internalization of LRP6 and accumulation of beta-catenin. Caveolin is necessary for Wnt-3a-dependent internalization of LRP6 and accumulation of beta-catenin. Dev. Cell (1534-5807) 2006 imex curation Yamamoto H., Komekado H., Kikuchi A. Cardiac - Interactions involving cardiac related proteins The authors have confirmed the species for Axin (rat), Fz5 (mouse) and GSK-3beta (human). hyamamoto@molbiobc.med.osaka-u.ac.jp, akikuchi@hiroshima-u.ac.jp 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Yamamoto H., Komekado H., Kikuchi A. Cardiac - Interactions involving cardiac related proteins The authors have confirmed the species for Axin (rat), Fz5 (mouse) and GSK-3beta (human). hyamamoto@molbiobc.med.osaka-u.ac.jp, akikuchi@hiroshima-u.ac.jp Accepted 2013-SEP-23 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. Dev. Cell (1534-5807) 2006 imex curation Caveolin is necessary for Wnt-3a-dependent internalization of LRP6 and accumulation of beta-catenin. Caveolin is necessary for Wnt-3a-dependent internalization of LRP6 and accumulation of beta-catenin. Dev. Cell (1534-5807) 2006 imex curation Yamamoto H., Komekado H., Kikuchi A. Cardiac - Interactions involving cardiac related proteins The authors have confirmed the species for Axin (rat), Fz5 (mouse) and GSK-3beta (human). hyamamoto@molbiobc.med.osaka-u.ac.jp, akikuchi@hiroshima-u.ac.jp 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-hela_s3 Homo sapiens HeLa-S3 cervix carcinoma cell line hela_s3 HeLa-S3 cervix carcinoma cell line Human cervix carcinoma cell line is a subclone of its parent HELA (DSM ACC 57) derived in 1955 confirmed as human with IEF of AST, MDH anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Yamamoto H., Komekado H., Kikuchi A. Cardiac - Interactions involving cardiac related proteins The authors have confirmed the species for Axin (rat), Fz5 (mouse) and GSK-3beta (human). hyamamoto@molbiobc.med.osaka-u.ac.jp, akikuchi@hiroshima-u.ac.jp Accepted 2013-SEP-23 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. Dev. Cell (1534-5807) 2006 imex curation Caveolin is necessary for Wnt-3a-dependent internalization of LRP6 and accumulation of beta-catenin. Caveolin is necessary for Wnt-3a-dependent internalization of LRP6 and accumulation of beta-catenin. Dev. Cell (1534-5807) 2006 imex curation Yamamoto H., Komekado H., Kikuchi A. Cardiac - Interactions involving cardiac related proteins The authors have confirmed the species for Axin (rat), Fz5 (mouse) and GSK-3beta (human). hyamamoto@molbiobc.med.osaka-u.ac.jp, akikuchi@hiroshima-u.ac.jp 30-Sept-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Yamamoto H., Komekado H., Kikuchi A. Cardiac - Interactions involving cardiac related proteins The author provided info about antibodies used in immunofluorescence:They are from BD. anti-RAB4 610888 (immunogen: human RAB4 aa.97-213) and anti-RAB5 610724 (immunogen: human RAB4 aa.1-215) The authors have confirmed the species for Axin (rat), Fz5 (mouse) and GSK-3beta (human). hyamamoto@molbiobc.med.osaka-u.ac.jp, akikuchi@hiroshima-u.ac.jp Accepted 2013-SEP-23 by ORCHARD 30-Sept-2013: Contacted by IntAct-Help. Dev. Cell (1534-5807) 2006 imex curation lrp6_human Low-density lipoprotein receptor-related protein 6 LRP6 protein protein human Homo sapiens Human MGAVLRSLLACSFCVLLRAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVFSHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINSEIYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDILYWTDWSTHSILACNKYTGEGLREIHSDIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERVHKRSAEREVIIDQLPDLMGLKATNVHRVIGSNPCAEENGGCSHLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQSGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPSQNLEIQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRSVGVVLKGEQDRPRAVVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEKNCEVLCLIDQFRCANGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGVIVTIFVSGTVYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS DIP protein O75581 original sequence version: 116 DIP protein O75581 original sequence version: 95 DIP protein O75581 original sequence version: 131 DIP protein O75581 original sequence version: 112 DIP protein O75581 original sequence version: 136 DIP protein O75581 original sequence version: 59 DIP protein O75581 original sequence version: 103 DIP protein O75581 original sequence version: 100 413D2CF70A5D8B5C cav1_human Caveolin-1 CAV1 CAV protein protein human Homo sapiens Human MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI DIP protein Q03135 original sequence version: 164 DIP protein Q03135 original sequence version: 119 DIP protein Q03135 original sequence version: 122 DIP protein Q03135-1 original sequence version: 122 DIP protein Q03135 original sequence version: 133 DIP protein Q03135 original sequence version: 155 DIP protein Q03135 original sequence version: 147 2424DE9B5E6521D5 fzd5_mouse Frizzled-5 Fzd5 protein protein mouse Mus musculus Mouse MARPDPSAPPSLLLLLLAQLVGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGGDAEVLCMDYNRSEATTASPKSFPAKPTLPGPPGAPSSGGECPSGGPSVCTCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSPDERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSREHSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLLAGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAALTCACPGPDAGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTLESWRRFTSRCCCSSRRGHKSGGAMAAGDYAEASAALTGRTGPPGPTAAYHKQVSLSHV DIP protein Q9EQD0 original sequence version: 103 mint Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Plays a role in yolk sac angiogenesis and in placental vascularization. Binds to Wnt2, Wnt10B, Wnt5A, but not to Wnt2B or Wnt4 5FC03620AF087733 gsk3b_human Glycogen synthase kinase-3 beta GSK3B Serine/threonine-protein kinase GSK3B protein protein human Homo sapiens Human MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST DIP protein P49841 original sequence version: 109 DIP protein P49841 original sequence version: 136 DIP protein P49841 original sequence version: 143 DIP protein P49841 original sequence version: 141 DIP protein P49841 original sequence version: 196 DIP protein P49841 original sequence version: 159 DIP protein P49841 original sequence version: 151 4ACC24D00CDBB9C3 ctnb1_human Catenin beta-1 Beta-catenin OK/SW-cl.35 PRO2286 CTNNB1 CTNNB protein protein human Homo sapiens Human MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL DIP protein P35222 original sequence version: 187 DIP protein P35222 original sequence version: 188 DIP protein P35222 original sequence version: 180 DIP protein P35222-1 original sequence version: 181 DIP protein P35222 original sequence version: 181 DIP protein P35222 original sequence version: 107 DIP protein P35222-1 original sequence version: 107 DIP protein P35222 original sequence version: 103 DIP protein P35222-1 original sequence version: 103 DIP protein P35222 original sequence version: 175 DIP protein P35222 original sequence version: 136 DIP protein P35222 original sequence version: 135 DIP protein P35222 original sequence version: 131 DIP protein P35222-1 original sequence version: 133 DIP protein P35222 original sequence version: 133 DIP protein P35222 original sequence version: 148 DIP protein P35222-1 original sequence version: 139 DIP protein P35222 original sequence version: 139 DIP protein P35222 original sequence version: 146 DIP protein P35222 original sequence version: 196 DIP protein P35222 original sequence version: 192 DIP protein P35222 original sequence version: 185 DIP protein P35222 original sequence version: 151 DIP protein P35222-1 original sequence version: 151 DIP protein P35222-1 original sequence version: 171 DIP protein P35222-1 original sequence version: 148 DIP protein P35222 original sequence version: 177 DIP protein P35222 original sequence version: 178 DIP protein P35222-1 original sequence version: 178 CB78F165A3EEF86E axin1_rat Axin-1 Axin1 Axin Axis inhibition protein 1 protein protein rat Rattus norvegicus (Rat) Rat MNVQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDSRPVNHSFCSGKGTSIKSETSTATPRRSDLDLGYEPEGSASPTPPYLRWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACSGFRKLEPCDSNEEKRLKLARAIYRKYILDSNGIVSRQTKPATKSFIKDCVMKQQIDPAMFDQAQTEIQSTMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGMSGYLPTLNEDEEWKCDQDADEDDGRDSVPPSRLTQKLLLETAAPRAPSSRRYNEGRELRYGSWREPVNPYYVNSGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRKQHRREMQESVQVNGRVPLPHIPRTYRMPKEIRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVRMEEEGEDGEMPSGPMASHKLPSVPAWHHFPPRYVDMGCSGLRDAHEENPESILDEHVQRVMRTPGCQSPGPGHRSPDSGHVAKTAVLGGTASGHGKHAPKLGLKLDSAGLHHHRHVHHHVHHNSARPKEQMEAEAARRVQSSFSWGPETHGHAKPRSYSESTGTNPSAGDLAFGGKASAPSKRNTKKAESGKNASAEVPSTTEDAEKNQKIMQWIIEGEKEISRHRKAGHGSSGMRKQQAHESSRPLSIERPGAVHPWVSAQLRNSVQPSHLFIQDPTMPPNPAPNPLTQLEEARRRLEEEEKRANKLPSKQRTKSQRKAGGGSAPPCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAILPVFEEKIIGKVEKVD BB1EE9CCECF6D487 BB1EE9CCECF6D487 rb11a_human Ras-related protein Rab-11A YL8 RAB11A RAB11 protein protein human Homo sapiens Human MGTRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI DIP protein P62491 original sequence version: 38 DIP protein P62491-1 original sequence version: 132 DIP protein P62491 original sequence version: 122 DIP protein P62491 original sequence version: 89 DIP protein P62491-1 original sequence version: 137 DIP protein P62491 original sequence version: 136 DIP protein P62491 original sequence version: 137 DIP protein P62491-1 original sequence version: 140 76FC1E113A29B269 eea1_human Early endosome antigen 1 EEA1 ZFYVE2 Endosome-associated protein p162 Zinc finger FYVE domain-containing protein 2 protein protein human Homo sapiens Human MLRRILQRTPGRVGSQGSDLDSSATPINTVDVNNESSSEGFICPQCMKSLGSADELFKHYEAVHDAGNDSGHGGESNLALKRDDVTLLRQEVQDLQASLKEEKWYSEELKKELEKYQGLQQQEAKPDGLVTDSSAELQSLEQQLEEAQTENFNIKQMKDLFEQKAAQLATEIADIKSKYDEERSLREAAEQKVTRLTEELNKEATVIQDLKTELLQRPGIEDVAVLKKELVQVQTLMDNMTLERERESEKLKDECKKLQSQYASSEATISQLRSELAKGPQEVAVYVQELQKLKSSVNELTQKNQTLTENLLKKEQDYTKLEEKHNEESVSKKNIQATLHQKDLDCQQLQSRLSASETSLHRIHVELSEKGEATQKLKEELSEVETKYQHLKAEFKQLQQQREEKEQHGLQLQSEINQLHSKLLETERQLGEAHGRLKEQRQLSSEKLMDKEQQVADLQLKLSRLEEQLKEKVTNSTELQHQLDKTKQQHQEQQALQQSTTAKLREAQNDLEQVLRQIGDKDQKIQNLEALLQKSKENISLLEKEREDLYAKIQAGEGETAVLNQLQEKNHTLQEQVTQLTEKLKNQSESHKQAQENLHDQVQEQKAHLRAAQDRVLSLETSVNELNSQLNESKEKVSQLDIQIKAKTELLLSAEAAKTAQRADLQNHLDTAQNALQDKQQELNKITTQLDQVTAKLQDKQEHCSQLESHLKEYKEKYLSLEQKTEELEGQIKKLEADSLEVKASKEQALQDLQQQRQLNTDLELRATELSKQLEMEKEIVSSTRLDLQKKSEALESIKQKLTKQEEEKKILKQDFETLSQETKIQHEELNNRIQTTVTELQKVKMEKEALMTELSTVKDKLSKVSDSLKNSKSEFEKENQKGKAAILDLEKTCKELKHQLQVQMENTLKEQKELKKSLEKEKEASHQLKLELNSMQEQLIQAQNTLKQNEKEEQQLQGNINELKQSSEQKKKQIEALQGELKIAVLQKTELENKLQQQLTQAAQELAAEKEKISVLQNNYEKSQETFKQLQSDFYGRESELLATRQDLKSVEEKLSLAQEDLISNRNQIGNQNKLIQELKTAKATLEQDSAKKEQQLQERCKALQDIQKEKSLKEKELVNEKSKLAEIEEIKCRQEKEITKLNEELKSHKLESIKEITNLKDAKQLLIQQKLELQGKADSLKAAVEQEKRNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEAKLTMQITALNENLGTVKKEWQSSQRRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG 51BA418F561E3411 eea1-lrp6 4 5 tag fluorescence tag visualisation by fluorescence tag fluorescence immunostaining immunostaining unspecified role unspecified role neutral component neutral component fixed cell fixed cell region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 antibody detection identification by antibody antibody detection immunostaining immunostaining unspecified role unspecified role neutral component neutral component fixed cell fixed cell colocalization colocalization Fig. S1 mouse Wnt-3a: P27467 Wnt-3a stimulation was for 1 h. lrp6-rab11a 4 5 tag fluorescence tag visualisation by fluorescence tag fluorescence immunostaining immunostaining unspecified role unspecified role neutral component neutral component fixed cell fixed cell region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 tag fluorescence tag visualisation by fluorescence tag fluorescence immunostaining immunostaining unspecified role unspecified role neutral component neutral component fixed cell fixed cell region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. S1 The co-localization is little and the authors speculate that the internalised LRP6 gets transported to early endosomes. Wnt-3a: P27467 Wnt-3a stimulation was for 3 h cav1-lrp6 1 5 unspecified role unspecified role neutral component neutral component region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 2A, B mouse Wnt-3a: P27467 Wnt-3a stimulation causes colocalization in intracellular puncta In the absence of Wnt-3a colocalization is at the plasma membrane fzd5-rb11a 4 7 tag fluorescence tag visualisation by fluorescence tag fluorescence immunostaining immunostaining unspecified role unspecified role neutral component neutral component fixed cell fixed cell region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 anti tag immunost anti tag immunostaining anti tag immunost immunostaining immunostaining unspecified role unspecified role neutral component neutral component fixed cell fixed cell region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. S3 The co-localization is little and the authors speculate that the internalised LRP6 gets transported to early endosomes. Wnt-3a: P27467 Wnt-3a stimulation was for 3 h eea1-fzd5-1 4 7 tag fluorescence tag visualisation by fluorescence tag fluorescence immunostaining immunostaining unspecified role unspecified role neutral component neutral component fixed cell fixed cell region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 antibody detection identification by antibody antibody detection immunostaining immunostaining unspecified role unspecified role neutral component neutral component fixed cell fixed cell colocalization colocalization Fig. S3 mouse Wnt-3a: P27467 Wnt-3a stimulation was for 1 h. axin1-lrp6-eea1 4 12 antibody detection identification by antibody antibody detection immunostaining immunostaining unspecified role unspecified role neutral component neutral component fixed cell fixed cell 5 tag fluorescence tag visualisation by fluorescence tag fluorescence immunostaining immunostaining unspecified role unspecified role neutral component neutral component fixed cell fixed cell region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 anti tag immunost anti tag immunostaining anti tag immunost immunostaining immunostaining unspecified role unspecified role neutral component neutral component fixed cell fixed cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 5C mouse Wnt-3a: P27467 Wnt-3a stimulation was for 1 h. GSK3-beta cav1-lrp6-1 3 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 2C mouse Wnt-3a lrp6-axin1 4 5 tag fluorescence tag visualisation by fluorescence tag fluorescence immunostaining immunostaining unspecified role unspecified role neutral component neutral component fixed cell fixed cell region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 anti-tag immunocytochemistry anti-tag immunocytochemistry immunostaining immunostaining unspecified role unspecified role neutral component neutral component fixed cell fixed cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 5A, B mouse Wnt-3a: P27467 Wnt-3a stimulation was for 5 min. GSK-3beta When Wnt-3a stimulation was for 1 h proteins were internalized. axin1-lrp6-cav1 4 6 antibody detection identification by antibody antibody detection immunostaining immunostaining unspecified role unspecified role neutral component neutral component fixed cell fixed cell 10 anti tag immunost anti tag immunostaining anti tag immunost immunostaining immunostaining unspecified role unspecified role neutral component neutral component fixed cell fixed cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 tag fluorescence tag visualisation by fluorescence tag fluorescence immunostaining immunostaining unspecified role unspecified role neutral component neutral component fixed cell fixed cell region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 5C mouse Wnt-3a: P27467 Wnt-3a stimulation was for 1 h. GSK3-beta axin1-eea1-lrp6 1 10 anti tag immunost anti tag immunostaining anti tag immunost immunostaining immunostaining unspecified role unspecified role neutral component neutral component fixed cell fixed cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 tag fluorescence tag visualisation by fluorescence tag fluorescence immunostaining immunostaining unspecified role unspecified role neutral component neutral component fixed cell fixed cell region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 antibody detection identification by antibody antibody detection immunostaining immunostaining unspecified role unspecified role neutral component neutral component fixed cell fixed cell colocalization colocalization Fig. 5C mouse Wnt-3a: P27467 Wnt-3a stimulation was for 1 h. GSK3-beta axin1-lrp6-cav1 1 6 antibody detection identification by antibody antibody detection immunostaining immunostaining unspecified role unspecified role neutral component neutral component fixed cell fixed cell 10 anti tag immunost anti tag immunostaining anti tag immunost immunostaining immunostaining unspecified role unspecified role neutral component neutral component fixed cell fixed cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 tag fluorescence tag visualisation by fluorescence tag fluorescence immunostaining immunostaining unspecified role unspecified role neutral component neutral component fixed cell fixed cell region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 5C mouse Wnt-3a: P27467 Wnt-3a stimulation was for 1 h. GSK3-beta axin1-lrp6-1 2 5 tag fluorescence tag visualisation by fluorescence tag fluorescence western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey fixed cell fixed cell region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O75581:p.Ser1490Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain S A Wed May 02 20:19:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser1490ala' Tue Jun 30 16:27:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser1490Ala' 10 anti tag immunost anti tag immunostaining anti tag immunost western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait fixed cell fixed cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 6B GSK-3b From in vitro phosphorylation experiment the authors suggest that GSK-3beta bound to Axin phosphorylates at least Ser1490 of LRP and the phosphorylation enhances the binding of Axin to LRP6. Should I make the comment below an interaction? I am not sure how.. axin1-cav1-lrp6 2 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 tag fluorescence tag visualisation by fluorescence tag fluorescence western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey fixed cell fixed cell region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 anti tag immunost anti tag immunostaining anti tag immunost western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait fixed cell fixed cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 6D GSK-3b axin1-cav1-1 2 10 anti tag immunost anti tag immunostaining anti tag immunost western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait fixed cell fixed cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 6D GSK-3b Expression of the Ser1490Ala mutant of RLP6 (LRP6SA) decreases the binding. axin1-cav1-lrp6-b-cat-gsk-3b 2 8 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey 5 tag fluorescence tag visualisation by fluorescence tag fluorescence western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey fixed cell fixed cell region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 anti tag immunost anti tag immunostaining anti tag immunost western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait fixed cell fixed cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 6E The binding of beta catenin is weak in the presence of caveolin axin1-ctnnb1-lrp6-gsk3b 2 8 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 anti tag immunost anti tag immunostaining anti tag immunost western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait fixed cell fixed cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey 5 tag fluorescence tag visualisation by fluorescence tag fluorescence western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey fixed cell fixed cell region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 6E axin1-cav1-lrp6-b-cat-gsk-3b 2 5 tag fluorescence tag visualisation by fluorescence tag fluorescence western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait fixed cell fixed cell region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 anti tag immunost anti tag immunostaining anti tag immunost western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey fixed cell fixed cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 6E The binding of beta catenin is weak in the presence of caveolin lrp6-axin1-beta-cat-gsk3-b 2 10 anti tag immunost anti tag immunostaining anti tag immunost western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey fixed cell fixed cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 tag fluorescence tag visualisation by fluorescence tag fluorescence western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait fixed cell fixed cell region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag predetermined featur predetermined feature predetermined featur undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey physical association physical association Fig. 6E fzd5-lrp6-2 4 7 anti-tag immunocytochemistry anti-tag immunocytochemistry immunostaining immunostaining unspecified role unspecified role neutral component neutral component fixed cell fixed cell region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 tag fluorescence tag visualisation by fluorescence tag fluorescence immunostaining immunostaining unspecified role unspecified role neutral component neutral component fixed cell fixed cell region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 4A mouse Wnt-3a: P27467 Wnt-3a stimulation was for 1 h.