UniProt UniProt http://www.uniprot.org The X-ray crystal structures of human alpha-phosphomannomutase 1 reveal the structural basis of congenital disorder of glycosylation type 1a. The X-ray crystal structures of human alpha-phosphomannomutase 1 reveal the structural basis of congenital disorder of glycosylation type 1a. J. Biol. Chem. (0021-9258) 2006 imex curation Silvaggi N.R., Zhang C., Lu Z., Dai J., Dunaway-Mariano D., Allen K.N. allen@med-xtal.bu.edu 22-Nov-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Silvaggi N.R., Zhang C., Lu Z., Dai J., Dunaway-Mariano D., Allen K.N. allen@med-xtal.bu.edu Accepted 2013-NOV-05 by ORCHARD 22-Nov-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2006 Only protein-protein interactions imex curation alpha-d-mannose 1-phosphate alpha-D-mannose 1-phosphate 1-O-phosphono-alpha-D-mannopyranose alpha-D-mannose 1-phosphate alpha-D-Mannose 1-phosphate alpha-D-mannopyranose 1-(dihydrogen phosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) HXXFSFRBOHSIMQ-RWOPYEJCSA-N HXXFSFRBOHSIMQ-RWOPYEJCSA-N magnesium(2+) Magnesium(2+) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) pmm1_human Phosphomannomutase 1 PMMH-22 PMM1 PMMH22 protein protein human Homo sapiens Human MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGVVGGSDYCKIAEQLGDGDEVIEKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEELLQDLINFCLSYMALLRLPKKRGTFIEFRNGMLNISPIGRSCTLEERIEFSELDKKEKIREKFVEALKTEFAGKGLRFSRGGMISFDVFPEGWDKRYCLDSLDQDSFDTIHFFGNETSPGGNDFEIFADPRTVGHSVVSPQDTVQRCREIFFPETAHEA 1FBA7BFC9C3BB0BB magnesium_2__-pmm1-2 1 3 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig 3 2.10 A R-factor: 0.187; R-free: 0.206 alpha_d_mannose_1_phosphate-magnesium_2__-1 1 3 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 2 unspecified role unspecified role neutral component neutral component direct interaction direct interaction Fig 3 1.75 A R-factor:0.204; R-free: 0.240