UniProt UniProt http://www.uniprot.org Myxoma virus M-T5 protects infected cells from the stress of cell cycle arrest through its interaction with host cell cullin-1. Myxoma virus M-T5 protects infected cells from the stress of cell cycle arrest through its interaction with host cell cullin-1. J. Virol. (0022-538X) 2005 imex curation Johnston J.B., Wang G., Barrett J.W., Nazarian S.H., Colwill K., Moran M., McFadden G. mcfadden@robarts.ca 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Johnston J.B., Wang G., Barrett J.W., Nazarian S.H., Colwill K., Moran M., McFadden G. mcfadden@robarts.ca Accepted 2013-JUN-25 by ORCHARD 02-Aug-2013: Contacted by IntAct-Help. J. Virol. (0022-538X) 2005 Only protein-protein interactions imex curation Myxoma virus M-T5 protects infected cells from the stress of cell cycle arrest through its interaction with host cell cullin-1. Myxoma virus M-T5 protects infected cells from the stress of cell cycle arrest through its interaction with host cell cullin-1. J. Virol. (0022-538X) 2005 imex curation Johnston J.B., Wang G., Barrett J.W., Nazarian S.H., Colwill K., Moran M., McFadden G. mcfadden@robarts.ca 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down anti tag western anti tag western blot anti tag western Johnston J.B., Wang G., Barrett J.W., Nazarian S.H., Colwill K., Moran M., McFadden G. mcfadden@robarts.ca Accepted 2013-JUN-25 by ORCHARD 02-Aug-2013: Contacted by IntAct-Help. J. Virol. (0022-538X) 2005 Only protein-protein interactions imex curation Myxoma virus M-T5 protects infected cells from the stress of cell cycle arrest through its interaction with host cell cullin-1. Myxoma virus M-T5 protects infected cells from the stress of cell cycle arrest through its interaction with host cell cullin-1. J. Virol. (0022-538X) 2005 imex curation Johnston J.B., Wang G., Barrett J.W., Nazarian S.H., Colwill K., Moran M., McFadden G. mcfadden@robarts.ca 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Johnston J.B., Wang G., Barrett J.W., Nazarian S.H., Colwill K., Moran M., McFadden G. mcfadden@robarts.ca Accepted 2013-JUN-25 by ORCHARD 02-Aug-2013: Contacted by IntAct-Help. J. Virol. (0022-538X) 2005 Only protein-protein interactions imex curation Myxoma virus M-T5 protects infected cells from the stress of cell cycle arrest through its interaction with host cell cullin-1. Myxoma virus M-T5 protects infected cells from the stress of cell cycle arrest through its interaction with host cell cullin-1. J. Virol. (0022-538X) 2005 imex curation Johnston J.B., Wang G., Barrett J.W., Nazarian S.H., Colwill K., Moran M., McFadden G. mcfadden@robarts.ca 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. pull down pull down western blot western blot Immuno blot Immuno blot Johnston J.B., Wang G., Barrett J.W., Nazarian S.H., Colwill K., Moran M., McFadden G. mcfadden@robarts.ca Accepted 2013-JUN-25 by ORCHARD 02-Aug-2013: Contacted by IntAct-Help. J. Virol. (0022-538X) 2005 Only protein-protein interactions imex curation Myxoma virus M-T5 protects infected cells from the stress of cell cycle arrest through its interaction with host cell cullin-1. Myxoma virus M-T5 protects infected cells from the stress of cell cycle arrest through its interaction with host cell cullin-1. J. Virol. (0022-538X) 2005 imex curation Johnston J.B., Wang G., Barrett J.W., Nazarian S.H., Colwill K., Moran M., McFadden G. mcfadden@robarts.ca 02-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Johnston J.B., Wang G., Barrett J.W., Nazarian S.H., Colwill K., Moran M., McFadden G. mcfadden@robarts.ca Accepted 2013-JUN-25 by ORCHARD 02-Aug-2013: Contacted by IntAct-Help. J. Virol. (0022-538X) 2005 Only protein-protein interactions imex curation mt5_myxvl Ankyrin repeat domain-containing protein M-T5 m005R m005L M-T5 protein protein protein myxvl Myxoma virus (strain Lausanne) MDLYGYVSCTPRIRHDVLDGLLNVYDPDELCSRDTPFRLYLTRYDCTPEGLRLFLTRGADVNGVRGSRTSPLCTVLSNKDLGNEAEALAKQLIDAGADVNAMAPDGRYPLLCLLENDRINTARFVRYMIDRGTSVYVRGTDGYGPVQTYIHSKNVVLDTLRELVRAGATVHDPDKTYGFNVLQCYMIAHVRSSNVQILRFLLRHGVDSSRGLHATVMFNTLERKISHGVFNRKVLDFIFTQISINEQNSLDFTPINYCVIHNDRRTFDYLLERGADPNVVNFLGNSCLDLAVLNGNKYMVHRLLRKTITPDAYTRALNVVNSNIYSIKSYGMSEFVKRHGTLYKALIRSFVKDSDREIFTYVHIYDYFREFVDECIRERDAMKADVLDAVSVFDTAFGLVARPRWKHVRILSKYVRGVYGDRVKKILRSLHKRRFKTDRLVRRIADLCGPDGLWTRLPVEVRYSVVDYLTDDEIHDLFVKIHA DIP protein Q83730 original sequence version: 74 769E3B7F7E52F586 cul1_human Cullin-1 CUL1 protein protein human Homo sapiens Human MSSTRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSNQARGAGVPPSKSKKGQTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVTNAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVYKESFESQFLADTERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHLEIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAALNDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLVLEDENANVDEVELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA DIP protein Q13616 original sequence version: 144 DIP protein Q13616 original sequence version: 133 DIP protein Q13616 original sequence version: null DIP protein Q13616 original sequence version: 135 DIP protein Q13616 original sequence version: 98 DIP protein Q13616 original sequence version: 110 DIP protein Q13616 original sequence version: 146 DIP protein Q13616 original sequence version: 148 DIP protein Q13616 original sequence version: 100 DIP protein Q13616 original sequence version: 85 DIP protein Q13616 original sequence version: 114 DIP protein Q13616 original sequence version: 119 DIP protein Q13616 original sequence version: 136 DIP protein Q13616 original sequence version: 117 DIP protein Q13616 original sequence version: 99 DIP protein Q13616 original sequence version: 108 6625A1FFA7799BBA m005r-cul1 5 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2A m005r-cul1-1 4 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed c-terminal tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 2B cul1-m005r 2 7 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminal tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 6 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2C m005r-cul1-2 1 6 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role prey prey physical association physical association 2D cul1-m005r-1 3 7 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization 3I