UniProt UniProt http://www.uniprot.org Four distinct classes of proteins as interaction partners of the PABC domain of Arabidopsis thaliana Poly(A)-binding proteins. Four distinct classes of proteins as interaction partners of the PABC domain of Arabidopsis thaliana Poly(A)-binding proteins. Mol. Genet. Genomics (1617-4615) 2005 imex curation Bravo J., Aguilar-Henonin L., Olmedo G., Guzmán P. pguzman@ira.cinvestav.mx 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Bravo J., Aguilar-Henonin L., Olmedo G., Guzmán P. pguzman@ira.cinvestav.mx Accepted 2013-MAY-07 by ORCHARD 17-Jun-2013: Contacted by IntAct-Help. Mol. Genet. Genomics (1617-4615) 2005 Only protein-protein interactions imex curation Four distinct classes of proteins as interaction partners of the PABC domain of Arabidopsis thaliana Poly(A)-binding proteins. Four distinct classes of proteins as interaction partners of the PABC domain of Arabidopsis thaliana Poly(A)-binding proteins. Mol. Genet. Genomics (1617-4615) 2005 imex curation Bravo J., Aguilar-Henonin L., Olmedo G., Guzmán P. pguzman@ira.cinvestav.mx 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Bravo J., Aguilar-Henonin L., Olmedo G., Guzmán P. pguzman@ira.cinvestav.mx Accepted 2013-MAY-07 by ORCHARD 17-Jun-2013: Contacted by IntAct-Help. Mol. Genet. Genomics (1617-4615) 2005 Only protein-protein interactions imex curation pabp2_arath Polyadenylate-binding protein 2 PAB2 F28A23.130 At4g34110 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAQVQLQGQTPNGSTAAVTSAPATSGGATATQFGNTSLYVGDLDFNVTDSQLFDAFGQMGTVVTVRVCRDLVTRRSLGYGYVNFTNPQDAARAIQELNYIPLYGKPIRVMYSHRDPSVRRSGAGNIFIKNLDESIDHKALHDTFSSFGNIVSCKVAVDSSGQSKGYGFVQYANEESAQKAIEKLNGMLLNDKQVYVGPFLRRQERDSTANKTKFTNVYVKNLAESTTDDDLKNAFGEYGKITSAVVMKDGEGKSKGFGFVNFENADDAARAVESLNGHKFDDKEWYVGRAQKKSERETELRVRYEQNLKEAADKFQSSNLYVKNLDPSISDEKLKEIFSPFGTVTSSKVMRDPNGTSKGSGFVAFATPEEATEAMSQLSGKMIESKPLYVAIAQRKEDRRVRLQAQFSQVRPVAMQPSVGPRMPVYPPGGPGIGQQMFYGQAPPAMIPPQPGYGYQQQLVPGMRPGGGPVPSFFMPMVQPQQQRPGGGRRPGGIQHSQQQNPMMQQQMHPRGRMFRYPQGRGGSGDVPPYDMGNNMPLTIGALASNLSNATPEQQRTMLGEVLYPLVEQVEAESAAKVTGMLLEMDQTEVLHLLESPEALKAKVAEAMDVLRSVAAGGATEQLASLNLS 0F809818D08BDC7E cid8_arath Polyadenylate-binding protein-interacting protein 8 CID8 PAM2-containing protein CID8 Protein CTC-INTERACTING DOMAIN 8 F22G10.7 At1g53650 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAAITEMATDSNDVINDGGTGDGIEKSTDSKPEIESDDLKPKSKPEYDQMKKLVAMFKKLNPEAKEFFPSYKRNTNQSDDFVIAIKPSGEDNKKVAINRRRRNNYNQGRRVRLPGRASKAQREDSIRRTVYVSDIDQSVTEEGLAGLFSSCGQVVDCRICGDPNSVLRFAFVEFSDDQGARSALSLGGTMIGYYPVRVLPSKTAILPVNPTFLPRSEDEREMCSRTIYCTNVDKNATEDDVNTFFQSACGEVTRLRLLGDQVHSTRIAFVEFAMAESAVAALNCSGIVLGSQPIRVSPSKTPVRSRITRSPSPN 64B3CA9E19796A62 cid4_arath Polyadenylate-binding protein-interacting protein 4 CID4 PAM2-containing protein CID4 Protein CTC-INTERACTING DOMAIN 4 MDC16.14 At3g14010 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSIPQSKSSSNGFPLKRGETEEVLHKTNTSNTVFNGEAGSLKRLSLDRLVYFTTCKIGHHVEVHLRNGSVYTGIFHAANVEKDFGIILKMACLIKDGTLRGHKSRSEFVRKPPSKTFIIPADELVQVIAKDLSVSSNNMSNAVQGEKPSELLTDSSISQSYHVDRERQLQRWVPDETIPHGADLENVFDNPWNRKWNQFEVNKSLFGVKSTFDEDLYTTRLERGPQTKQLEEHAQKIAREIEAETTRDIHVAEERGLQLNENFDFDEEARYSSVRPVTGFGDSGFDLEDNALLDTCNDLTFGGSSTSDGQKPASSGKGCEELRVSGDSQSSRKNKNVDQSCSTSKQQSKDFPAAGSNISESQLDEQRRKNNEEVSHNNRSAEESTSGHGDIKEGAKSGGGASSVSKAVTEREREASQVSSKTKSESSFGQSASRSSESRPGPSTSSRPGLSPSSSIGSMASSEKSTLNPNAKEFKLNPKAKSFKPLQSAAAPPQSPIADASFYYPGPSHVPVQQMPGMPPVNYGLPPYPGNQPQMMYHPQAYYHPNGQPQYPQQQMIPGQQQQQMIPGQQHPRPVYYMHPPPYPQDMPYHNKGRE 23D27520F2A2B7CC cid5_arath Polyadenylate-binding protein-interacting protein 5 CID5 IPD1 PAM2-containing protein CID5 Protein CTC-INTERACTING DOMAIN 5 Protein INCREASED POLYPLOIDY LEVEL IN DARKNESS 1 F15N18_30 At5g11440 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKPGAFALNPHAASYVPISKRVDYGGGDDGLVFAAKSPTVEVSMPKKSSEMAYKQIRDDDLDLEMDIDMDIEYLLVTFSGLSQESITDVYLANGGDLEATIEMLNQLEIYSTESEENLPETLDIGDISESGPSTSKSTEVAASTSSVIPNAPVSA 05A9F8A4004B01A5 erd15_arath Protein EARLY RESPONSIVE TO DEHYDRATION 15 ERD15 CID1 LSR1 Protein CTC-INTERACTING DOMAIN 1 Protein LIGHT STRESS-REGULATED 1 F13H10.2 T26J13.2 At2g41430 PAM2-containing protein CID1 Polyadenylate-binding protein-interacting protein 1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAMVSGRRSTLNPDAPLFIPAAVRQVEDFSPEWWQLVTTSTWYPDYWISQQQQGADGFYDNGENENGGGHIDVADLLPESFDFDDMEDFFDTDAAEFDQGFDGRMYYQAPSEFGFGKNGEMVKKSSGNRSPRSIVEPAKYAEKPAKWGNQRVAAAPRNIHQPR F110A4F395417223 pabp5_arath Polyadenylate-binding protein 5 PAB5 F14O23.15 At1g71770 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAAAVASGIAPTTAMVDQVIPNQPTVAAAAPPPFPAVSQVAAVAAAAAAAEALQTHPNSSLYVGDLDPSVNESHLLDLFNQVAPVHNLRVCRDLTHRSLGYAYVNFANPEDASRAMESLNYAPIRDRPIRIMLSNRDPSTRLSGKGNVFIKNLDASIDNKALYETFSSFGTILSCKVAMDVVGRSKGYGFVQFEKEETAQAAIDKLNGMLLNDKQVFVGHFVRRQDRARSESGAVPSFTNVYVKNLPKEITDDELKKTFGKYGDISSAVVMKDQSGNSRSFGFVNFVSPEAAAVAVEKMNGISLGEDVLYVGRAQKKSDREEELRRKFEQERISRFEKLQGSNLYLKNLDDSVNDEKLKEMFSEYGNVTSCKVMMNSQGLSRGFGFVAYSNPEEALLAMKEMNGKMIGRKPLYVALAQRKEERQAHLQSLFTQIRSPGTMSPVPSPMSGFHHHPPGGPMSGPHHPMFIGHNGQGLVPSQPMGYGYQVQFMPGMRPGAGPPNFMMPFPLQRQTQPGPRVGFRRGANNMQQQFQQQQMLQQNASRFMGGAGNRRNGMEASAPQGIIPLPLNASANSHNAPQRSHKPTPLTISKLASDLALASPDKHPRMLGDHLYPLVEQQEPANAAKVTGMLLEMDQAEILHLLESPEALKAKVSEALDVLRRSADPAAVSSVDDQFALSSSE 3D0AA61682B8B91D cid7_arath Polyadenylate-binding protein-interacting protein 7 CID7 PAM2-containing protein CID7 Protein CTC-INTERACTING DOMAIN 7 T1D16.8 At2g26280 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSLTKKASEPKLSGTSIKPTTLNPHAAEFVPFTLRSPSSGGTSTLDTRLLASSSSVGKAVLDRTESSASHHSDEEARQFWSHQLPDDITPDFGLMTQDDNSYGSGSLSLANLSLFDGNEAEKFPSASGGYGFSDQTGLASHNANGNSLADKSRYPISSFGEDPQRQSFMQLSPKPWDKQIMNAEQLLGNDRERNPFSGKSRHGFVNDMITESPGDMEVNPVDFLASQFPGFAAESLAEVYFANGCDLQLTIEMLTQLELQVDGGLNQNISPKTYAPPSLTPMDFPALSISNSHGIPAQFGGDDLQQTGNHYQSPEKDNMFFFKSGPSVSQPGAIDYVSAVRKLASQDSGMWKYERNDSADSSIGSSRNSGAYKSGRGRSIYSDKLQSRAQTRPAPVWVETGDAVGNMYSELREEARDYARLRNVYFEQARQAYLVGNKALAKELSVKGQLHNMQMKAAHGKAQEAIYRQRNPVGQGNSRGNERMIDLHGLHVSEALQVLKHELSVLRSTARATQERLQIYICVGTGHHTRGSRTPARLPVAVQRYLLEEEGLDYSEPQAGLLRVIIY 85F888BE2D90F03E pab2-erd15 1 3 unspecified role unspecified role bait bait c-term sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey physical association physical association pab2-cid7 1 3 unspecified role unspecified role bait bait c-term sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role prey prey physical association physical association pab2-erd15-1 2 3 unspecified role unspecified role bait bait c-term sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey pam2 motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain pam2 motif required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain 22 20 physical association physical association Fig. 3B, Table 1 pab2-cid7-1 2 9 unspecified role unspecified role prey prey pam2 motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role bait bait c-term sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 28 26 physical association physical association Fig. 3C, Table 1 pab5-cid7 2 9 unspecified role unspecified role prey prey pam2 motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role bait bait c-term sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 31 33 physical association physical association Table 1 pab5-erd15 2 8 unspecified role unspecified role bait bait c-term sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey pam2 motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 36 38 physical association physical association Table 1 pab5-cid4 2 5 unspecified role unspecified role prey prey pam2 motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role bait bait c-term sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 43 41 physical association physical association Table 1 pab2-cid4 2 5 unspecified role unspecified role prey prey pam2 motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role bait bait c-term sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 46 48 physical association physical association Table 1 pab2-cid5 2 6 unspecified role unspecified role prey prey pam2 motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role bait bait c-term sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 53 51 physical association physical association Table 1 pab5-cid5 2 6 unspecified role unspecified role prey prey pam2 motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role bait bait c-term sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 56 58 physical association physical association Table 1 pab2-cid8 2 4 unspecified role unspecified role prey prey pam2 motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role bait bait c-term sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 61 63 physical association physical association Table 1 pab5-cid8 2 4 unspecified role unspecified role prey prey pam2 motif sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role bait bait c-term sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 68 66 physical association physical association Table 1