IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interaction of the sliding clamp beta-subunit and Hda, a DnaA-related protein. Interaction of the sliding clamp beta-subunit and Hda, a DnaA-related protein. J. Bacteriol. (0021-9193) 2004 imex curation Kurz M., Dalrymple B., Wijffels G., Kongsuwan K. kritaya.kongsuwan@csiro.au 8-May-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Kurz M., Dalrymple B., Wijffels G., Kongsuwan K. kritaya.kongsuwan@csiro.au Accepted 2013-APR-25 by ORCHARD 8-May-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2004 Only protein-protein interactions imex curation Interaction of the sliding clamp beta-subunit and Hda, a DnaA-related protein. Interaction of the sliding clamp beta-subunit and Hda, a DnaA-related protein. J. Bacteriol. (0021-9193) 2004 imex curation Kurz M., Dalrymple B., Wijffels G., Kongsuwan K. kritaya.kongsuwan@csiro.au 8-May-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight by comassie molecular weight estimation by coomasie staining weight by comassie Kurz M., Dalrymple B., Wijffels G., Kongsuwan K. kritaya.kongsuwan@csiro.au Accepted 2013-APR-25 by ORCHARD 8-May-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2004 Only protein-protein interactions imex curation dpo3b_ecoli Beta sliding clamp dnaN Beta-clamp processivity factor DNA polymerase III beta sliding clamp subunit JW3678 b3701 protein protein ecoli Escherichia coli (strain K12) MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVALVQPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGERMLVRSGRSRFSLSTLPAADFPNLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELRTVATDGHRLAVCSMPIGQSLPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKHLEAGCDLLKQAFARAAILSNEKFRGVRLYVSENQLKITANNPEQEEAEEILDVTYSGAEMEIGFNVSYVLDVLNALKCENVRMMLTDSVSSVQIEDAASQSAAYVVMPMRL DIP protein P0A988 original sequence version: 48 This sequence has been withdrawn from Uniprot. 7A45646F61255B5A hda_ecoli DnaA regulatory inactivator Hda hda yfgE DnaA paralog idaB f248c JW5397 b2496 protein protein ecoli Escherichia coli (strain K12) MNTPAQLSLPLYLPDDETFASFWPGDNSSLLAALQNVLRQEHSGYIYLWAREGAGRSHLLHAACAELSQRGDAVGYVPLDKRTWFVPEVLDGMEHLSLVCIDNIECIAGDELWEMAIFDLYNRILESGKTRLLITGDRPPRQLNLGLPDLASRLDWGQIYKLQPLSDEDKLQALQLRARLRGFELPEDVGRFLLKRLDREMRTLFMTLDQLDRASITAQRKLTIPFVKEILKL DIP protein P69931 original sequence version: 45 DIP protein P69931 original sequence version: null D25C7CDF31DAF7DC hda-dnan 1 3 unspecified role unspecified role prey prey n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range tag is 10x histidine ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P69931:p.[Leu7Ala;Leu9Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain L A Wed May 02 15:46:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu7ala,leu9ala' Tue Jun 30 19:36:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu7Ala;Leu9Ala]' P69931:p.[Leu9Ala;Pro10Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain P A Wed May 02 17:48:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu9ala,pro10ala' Tue Jun 30 18:11:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu9Ala;Pro10Ala]' ecoli Escherichia coli (strain K12) according to authors, similar results were found with 10x histidine tag. direct interaction direct interaction Fig. 1 dnan-hda 2 3 unspecified role unspecified role bait bait n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey P69931:p.[Leu9Ala;Pro10Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain P A Wed May 02 15:36:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu9ala,pro10ala' Tue Jun 30 18:57:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu9Ala;Pro10Ala]' P69931:p.[Leu7Ala;Leu9Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain L A Wed May 02 18:34:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu7ala,leu9ala' Tue Jun 30 19:16:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu7Ala;Leu9Ala]' n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2 hda-dnan-2 1 4 inhibitor inhibitor prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain P69931:p.[Pro4_Ala5delinsIleGly;Tyr12_Leu13delinsGlyVal] mutation mutation certain certain sequence position certain certain certain sequence position certain YL GV certain certain sequence position certain certain certain sequence position certain PA IG Thu Jul 07 12:07:29 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was pro4ile/ala5gly/tyr12gly/leu13val Fri Jul 22 10:57:12 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'pro4ile,ala5gly,tyr12gly,leu13val' Wed May 02 19:14:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro_ala4-5ile_gly,tyr_leu12-13gly_val' Tue Jun 30 19:41:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro4_Ala5delinsIleGly;Tyr12_Leu13delinsGlyVal]' P69931:p.[Pro4_Ala5delinsIleGly;Pro10_Leu13delinsPheGlyVal] mutation mutation certain certain sequence position certain certain certain sequence position certain PA IG certain certain sequence position certain certain certain sequence position certain PLYL FGV. Thu Jul 07 12:07:27 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was pro4ile/ala5gly/pro10phe/leu11del/tyr12gly/leu13val Wed May 02 20:31:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro_ala4-5ile_gly,pro_leu_tyr_leu10-13phe_gly_val_del' Tue Jun 30 16:58:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro4_Ala5delinsIleGly;Pro10_Leu13delinsPheGlyVal]' chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role prey prey n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range tag is 10x histidine ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) according to authors, similar results were found with 10x histidine tag. physical association physical association Table 2