UniProt UniProt http://www.uniprot.org DISTORTED2 encodes an ARPC2 subunit of the putative Arabidopsis ARP2/3 complex. DISTORTED2 encodes an ARPC2 subunit of the putative Arabidopsis ARP2/3 complex. Plant J. (0960-7412) 2004 imex curation El-Din El-Assal S., Le J., Basu D., Mallery E.L., Szymanski D.B. dszyman@purdue.edu 8-May-2012: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined El-Din El-Assal S., Le J., Basu D., Mallery E.L., Szymanski D.B. dszyman@purdue.edu Accepted 2013-APR-23 by ORCHARD 8-May-2012: Contacted by IntAct-Help. Plant J. (0960-7412) 2004 Only protein-protein interactions imex curation arpc4_arath Actin-related protein 2/3 complex subunit 4 Actin-related protein C4 Arp2/3 complex 20 kDa subunit FCAALL.159 dl3115c At4g14147 ARPC4 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MANSLRLYLACIKNTLEAAMCLQNFPCQEVERHNKPEVELKTSPELLLNPVLICRNEAEKCLIETSINSLRISLKVKQADELENILTKKFLRFLSMRAEAFQVLRRKPVQGYDISFLITNYHCEEMQKQKLIDFIIQFMEDIEKEIRDLKESVNTRGRLVATEFLKQFM 5CB3BFF947D083AF arc2a_arath Actin-related protein 2/3 complex subunit 2A ARPC2A Actin-related protein C2A Arp2/3 complex 34 kDa subunit DIS2 Protein DISTORTED TRICHOMES 2 T17H7.13 At1g30825 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MILLQSHSRFLLQTLLTRAQNLDKAVELDYQWIEFDDVRYHVQVTMKNPNLLLLSVSLPNPPPEAMSFDGLPLGAIEAIKTTYGTGFQILDPPRDGFSLTLKLNFSKVRPDEELLTKLASIREVVMGAPLKIIFKHLASRTVAPELDRLVAIMHRPNETFFLVPQADKVTVAFPMRFKDSVDTILATSFLKEFVEARRAAALNTAPSCSWSPTAPQELEGAPKETLSANAGFVTFVIFPRHVEGKKLDRTVWNLSTFHAYVSYHVKFSEGFMHTRMRRRVESMIQALDQAKPLEKTRSMNNKSFKRLGLNEVNHTNSK 303D30BAC3EB3798 arpc4-arpc2a 1 3 unspecified role unspecified role prey prey 2 unspecified role unspecified role bait bait physical association physical association Fig. 4b