HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Direct interaction between alpha-actinin and hepatitis C virus NS5B. Direct interaction between alpha-actinin and hepatitis C virus NS5B. FEBS Lett. (0014-5793) 2003 imex curation Lan S., Wang H., Jiang H., Mao H., Liu X., Zhang X., Hu Y., Xiang L., Yuan Z. Virus - Publications including interactions involving viral proteins Human liver cDNA zhyuan@shmu.edu.cn 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip autoradiography autoradiography Lan S., Wang H., Jiang H., Mao H., Liu X., Zhang X., Hu Y., Xiang L., Yuan Z. Virus - Publications including interactions involving viral proteins Human liver cDNA zhyuan@shmu.edu.cn Accepted 2013-DEC-16 by ORCHARD FEBS Lett. (0014-5793) 2003 imex curation Direct interaction between alpha-actinin and hepatitis C virus NS5B. Direct interaction between alpha-actinin and hepatitis C virus NS5B. FEBS Lett. (0014-5793) 2003 imex curation Lan S., Wang H., Jiang H., Mao H., Liu X., Zhang X., Hu Y., Xiang L., Yuan Z. Virus - Publications including interactions involving viral proteins Human liver cDNA zhyuan@shmu.edu.cn 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lan S., Wang H., Jiang H., Mao H., Liu X., Zhang X., Hu Y., Xiang L., Yuan Z. Virus - Publications including interactions involving viral proteins Human liver cDNA zhyuan@shmu.edu.cn Accepted 2013-DEC-16 by ORCHARD FEBS Lett. (0014-5793) 2003 imex curation Direct interaction between alpha-actinin and hepatitis C virus NS5B. Direct interaction between alpha-actinin and hepatitis C virus NS5B. FEBS Lett. (0014-5793) 2003 imex curation Lan S., Wang H., Jiang H., Mao H., Liu X., Zhang X., Hu Y., Xiang L., Yuan Z. Virus - Publications including interactions involving viral proteins Human liver cDNA zhyuan@shmu.edu.cn 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-huh7 Homo sapiens hepatoma cell line established from a hepatocellular carcinoma huh7 Human hepatoma cell line established from a hepatocellular carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lan S., Wang H., Jiang H., Mao H., Liu X., Zhang X., Hu Y., Xiang L., Yuan Z. Virus - Publications including interactions involving viral proteins Human liver cDNA zhyuan@shmu.edu.cn Accepted 2013-DEC-16 by ORCHARD FEBS Lett. (0014-5793) 2003 imex curation Direct interaction between alpha-actinin and hepatitis C virus NS5B. Direct interaction between alpha-actinin and hepatitis C virus NS5B. FEBS Lett. (0014-5793) 2003 imex curation Lan S., Wang H., Jiang H., Mao H., Liu X., Zhang X., Hu Y., Xiang L., Yuan Z. Virus - Publications including interactions involving viral proteins Human liver cDNA zhyuan@shmu.edu.cn 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lan S., Wang H., Jiang H., Mao H., Liu X., Zhang X., Hu Y., Xiang L., Yuan Z. Virus - Publications including interactions involving viral proteins Human liver cDNA zhyuan@shmu.edu.cn Accepted 2013-DEC-16 by ORCHARD Human liver cDNA FEBS Lett. (0014-5793) 2003 imex curation Direct interaction between alpha-actinin and hepatitis C virus NS5B. Direct interaction between alpha-actinin and hepatitis C virus NS5B. FEBS Lett. (0014-5793) 2003 imex curation Lan S., Wang H., Jiang H., Mao H., Liu X., Zhang X., Hu Y., Xiang L., Yuan Z. Virus - Publications including interactions involving viral proteins Human liver cDNA zhyuan@shmu.edu.cn 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions imex curation chlae-cv-1 Monkey African Green kidney fibroblast Grivet cv-1 Monkey African Green kidney fibroblast confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Lan S., Wang H., Jiang H., Mao H., Liu X., Zhang X., Hu Y., Xiang L., Yuan Z. Virus - Publications including interactions involving viral proteins Human liver cDNA zhyuan@shmu.edu.cn Accepted 2013-DEC-16 by ORCHARD FEBS Lett. (0014-5793) 2003 imex curation actn1_human Alpha-actinin-1 ACTN1 Alpha-actinin cytoskeletal isoform Non-muscle alpha-actinin-1 F-actin cross-linking protein protein protein human Homo sapiens Human MDHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNAWGCLEQVEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIEMHGTLEDQLSHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGYDIGNDPQGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDKNYITMDELRRELPPDQAEYCIARMAPYTGPDSVPGALDYMSFSTALYGESDL 6DA3E4D1A0289519 haox1_human Hydroxyacid oxidase 1 HAO1 GOX1 HAOX1 Glycolate oxidase protein protein human Homo sapiens Human MLPRLICINDYEQHAKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLYPRMLRNVAETDLSTSVLGQRVSMPICVGATAMQRMAHVDGELATVRACQSLGTGMMLSSWATSSIEEVAEAGPEALRWLQLYIYKDREVTKKLVRQAEKMGYKAIFVTVDTPYLGNRLDDVRNRFKLPPQLRMKNFETSTLSFSPEENFGDDSGLAAYVAKAIDPSISWEDIKWLRRLTSLPIVAKGILRGDDAREAVKHGLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDVLKALALGAKAVFVGRPIVWGLAFQGEKGVQDVLEILKEEFRLAMALSGCQNVKVIDKTLVRKNPLAVSKI C683C6F7CB5FD323 cinp_human Cyclin-dependent kinase 2-interacting protein CINP protein protein human Homo sapiens Human MEAKTLGTVTPRKPVLSVSARKIKDNAADWHNLILKWETLNDAGFTTANNIANLKISLLNKDKIELDSSSPASKENEEKVCLEYNEELEKLCEELQATLDGLTKIQVKMEKLSSTTKGICELENYHYGEESKRPPLFHTWPTTHFYEVSHKLLEMYRKELLLKRTVAKELAHTGDPDLTLSYLSMWLHQPYVESDSRLHLESMLLETGHRAL DIP protein Q9BW66 original sequence version: 62 3678E123B8C206B1 ttc4_human Tetratricopeptide repeat protein 4 TTC4 My044 protein protein human Homo sapiens Human MEQPGQDPTSDDVMDSFLEKFQSQPYRGGFHEDQWEKEFEKVPLFMSRAPSEIDPRENPDLACLQSIIFDEERSPEEQAKTYKDEGNDYFKEKDYKKAVISYTEGLKKKCADPDLNAVLYTNRAAAQYYLGNFRSALNDVTAARKLKPCHLKAIIRGALCHLELKHFAEAVNWCDEGLQIDAKEKKLLEMRAKADKLKRIEQRDVRKANLKEKKERNQNEALLQAIKARNIRLSEAACEDEDSASEGLGELFLDGLSTENPHGARLSLDGQGRLSWPVLFLYPEYAQSDFISAFHEDSRFIDHLMVMFGETPSWDLEQKYCPDNLEVYFEDEDRAELYRVPAKSTLLQVLQHQRYFVKALTPAFLVCVGSSPFCKNFLRGRKVYQIR 4FA45889C4C9E427 psb4_human Proteasome subunit beta type-4 PSMB4 Macropain beta chain Multicatalytic endopeptidase complex beta chain Proteasome chain 3 26 kDa prosomal protein PROS26 Proteasome beta chain protein protein human Homo sapiens Human MEAFLGSRSGLWAGGPAPGQFYRIPSTPDSFMDPASALYRGPITRTQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE DIP protein P28070 original sequence version: 170 B8701C565069F563 p27958-pro_0000037577 RNA-directed RNA polymerase protein protein HCV77 Hepatitis C virus genotype 1a (isolate H77) SMSYSWTGALVTPCAAEEQKLPINALSNSLLRHHNLVYSTTSRSACQRKKKVTFDRLQVLDSHYQDVLKEVKAAASKVKANLLSVEEACSLAPPHSAKSKFGYGAKDVRCHARKAVAHINSVWKDLLEDSVTPIDTTIMAKNEVFCVQPEKGGRKPARLIVFPDLGVRVCEKMALYDVVSKLPLAVMGSSYGFQYSPGQRVEFLVQAWKSKKTPMGLSYDTRCFDSTVTESDIRTEEAIYQCCDLDPQARVAIKSLTERLYVGGPLTNSRGENCGYRRCRASRVLTTSCGNTLTRYIKARAACRAAGLQDCTMLVCGDDLVVICESAGVQEDAASLRAFTEAMTRYSAPPGDPPQPEYDLELITSCSSNVSVAHDGAGKRVYYLTRDPTTPLARAAWETARHTPVNSWLGNIIMFAPTLWARMILMTHFFSVLIARDQLEQALNCEIYGACYSIEPLDLPPIIQRLHGLSAFSLHSYSPGEINRVAACLRKLGVPPLRAWRHRAWSVRARLLARGGKAAICGKYLFNWAVRTKLKLTPITAAGRLDLSGWFTAGYSGGDIYHSVSHARPRWFWFCLLLLAAGVGIYLLPNR 2421 3011 2F89B19E29A81A02 ns5b-psb4-1 4 PSB4 10 unspecified role unspecified role prey prey NS5B 11 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association Results ns5b-actinin-2 1 ACTN1 6 unspecified role unspecified role bait bait ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NS5B 11 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Fig. 1A actn1-ns5b-1 1 ACTN1 6 unspecified role unspecified role prey prey 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NS5B 11 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 35s tag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro direct interaction direct interaction Fig. 1A ns5b-actinin-1 3 NS5B 11 unspecified role unspecified role prey prey ACTN1 6 unspecified role unspecified role bait bait physical association physical association Fig. 1B actn1-ns5b-2 5 ACTN1 6 anti-tag immunocytochemistry anti-tag immunocytochemistry tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NS5B 11 unspecified role unspecified role neutral component neutral component region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 2A p27958_pro-actn1-1 2 NS5B 11 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ACTN1 6 unspecified role unspecified role prey prey 43 44 physical association physical association Fig. 3 ns5b-cinp-1 4 8 unspecified role unspecified role prey prey NS5B 11 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association Results ns5b-ttc4-1 4 9 unspecified role unspecified role prey prey NS5B 11 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association Results ns5b-haox1-1 4 NS5B 11 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey physical association physical association Results ns5b-actn1-1 4 ACTN1 6 unspecified role unspecified role prey prey NS5B 11 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association Results actn1-p27958_pro-1 2 NS5B 11 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ACTN1 6 biological role biological role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 66 64 physical association physical association Fig. 3