bhf-ucl Identification of the KDR tyrosine kinase as a receptor for vascular endothelial cell growth factor. Identification of the KDR tyrosine kinase as a receptor for vascular endothelial cell growth factor. Biochem. Biophys. Res. Commun. (0006-291X) 1992 imex curation Terman B.I., Dougher-Vermazen M., Carrion M.E., Dimitrov D., Armellino D.C., Gospodarowicz D., Böhlen P. Cardiac - Interactions involving cardiac related proteins 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Terman B.I., Dougher-Vermazen M., Carrion M.E., Dimitrov D., Armellino D.C., Gospodarowicz D., Böhlen P. Cardiac - Interactions involving cardiac related proteins CMT-3 cells transfected with KDR-containing vector or vector alone were incubated for 90 minutes with 125l-VEGF. After washing the cells the samples were electrophoresed and visualised with an autoradiography Accepted 2014-JAN-16 by ORCHARD Biochem. Biophys. Res. Commun. (0006-291X) 1992 imex curation Identification of the KDR tyrosine kinase as a receptor for vascular endothelial cell growth factor. Identification of the KDR tyrosine kinase as a receptor for vascular endothelial cell growth factor. Biochem. Biophys. Res. Commun. (0006-291X) 1992 imex curation Terman B.I., Dougher-Vermazen M., Carrion M.E., Dimitrov D., Armellino D.C., Gospodarowicz D., Böhlen P. Cardiac - Interactions involving cardiac related proteins 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro competition binding competition binding tag visualisation tag visualisation Terman B.I., Dougher-Vermazen M., Carrion M.E., Dimitrov D., Armellino D.C., Gospodarowicz D., Böhlen P. Cardiac - Interactions involving cardiac related proteins Accepted 2014-JAN-16 by ORCHARD Specific binding of 125I VEGF to CMT-3 cells expressing KDR. CMT-3 cells were transiently transfected with the expression vector containing KDR coding sequence. After the incubation with binding medium and a washing step the soluble lysates were counted in a gamma counter. Biochem. Biophys. Res. Commun. (0006-291X) 1992 imex curation Identification of the KDR tyrosine kinase as a receptor for vascular endothelial cell growth factor. Identification of the KDR tyrosine kinase as a receptor for vascular endothelial cell growth factor. Biochem. Biophys. Res. Commun. (0006-291X) 1992 imex curation Terman B.I., Dougher-Vermazen M., Carrion M.E., Dimitrov D., Armellino D.C., Gospodarowicz D., Böhlen P. Cardiac - Interactions involving cardiac related proteins 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom tag visualisation tag visualisation Terman B.I., Dougher-Vermazen M., Carrion M.E., Dimitrov D., Armellino D.C., Gospodarowicz D., Böhlen P. Cardiac - Interactions involving cardiac related proteins Accepted 2014-JAN-16 by ORCHARD Specific binding of 125I VEGF to CMT-3 cells expressing KDR. CMT-3 cells were transiently transfected with the expression vector containing KDR coding sequence. After the incubation with binding medium and a washing step the soluble lysates were counted in a gamma counter. Biochem. Biophys. Res. Commun. (0006-291X) 1992 imex curation vgfr2_human Vascular endothelial growth factor receptor 2 Kinase insert domain receptor Protein-tyrosine kinase receptor flk-1 KDR FLK1 Fetal liver kinase 1 VEGFR2 protein protein human Homo sapiens Human MQSKVLLAVALWLCVETRAASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEATVGERVRIPAKYLGYPPPEIKWYKNGIPLESNHTIKAGHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVSLVVYVPPQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEEECANEPSQAVSVTNPYPCEEWRSVEDFQGGNKIEVNKNQFALIEGKNKTVSTLVIQAANVSALYKCEAVNKVGRGERVISFHVTRGPEITLQPDMQPTEQESVSLWCTADRSTFENLTWYKLGPQPLPIHVGELPTPVCKNLDTLWKLNATMFSNSTNDILIMELKNASLQDQGDYVCLAQDRKTKKRHCVVRQLTVLERVAPTITGNLENQTTSIGESIEVSCTASGNPPPQIMWFKDNETLVEDSGIVLKDGNRNLTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIIEGAQEKTNLEIIILVGTAVIAMFFWLLLVIILRTVKRANGGELKTGYLSIVMDPDELPLDEHCERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKTKGARFRQGKDYVGAIPVDLKRRLDSITSSQSSASSGFVEEKSLSDVEEEEAPEDLYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVSCMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDSGMVLASEELKTLEDRTKLSPSFGGMVPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYSSEEAELLKLIEIGVQTGSTAQILQPDSGTTLSSPPV DIP protein P35968 original sequence version: 81 DIP protein P35968 original sequence version: 146 DIP protein P35968 original sequence version: 117 DIP protein P35968 original sequence version: 121 59E7C44B05CFEBB3 p15692-4 Vascular endothelial growth factor A VEGF VEGFA VEGF Vascular permeability factor protein protein human Homo sapiens Human MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR DIP protein P15692-4 original sequence version: 150 CCE57097DD3779BD kdr-vegfa-4 2 5 unspecified role unspecified role prey prey region 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mouse-att_20 Mus musculus att_20 Mouse pituitary tumour 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain chlae-cmt3 Chlorocebus aethiops cmt-3 cmt-3 monkey kidney cells 5 competitor competitor competitor prey prey mouse-att_20 Mus musculus att_20 Mouse pituitary tumour physical association physical association Fig. 2 kdr-vegfa-7 1 4 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain chlae-cmt3 Chlorocebus aethiops cmt-3 cmt-3 monkey kidney cells 5 unspecified role unspecified role neutral component neutral component region 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mouse-att_20 Mus musculus att_20 Mouse pituitary tumour physical association physical association Fig.3 kdr-vegfa-12 3 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind full dna sequence full identification by DNA sequencing full dna sequence certain certain sequence position certain certain certain sequence position certain chlae-cmt3 Chlorocebus aethiops cmt-3 cmt-3 monkey kidney cells 5 unspecified role unspecified role prey prey region 125i radiolabel 125i radiolabel I125 125I 125I I125 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mouse-att_20 Mus musculus att_20 Mouse pituitary tumour physical association physical association Fig. 2