mbinfo MBInfo http://www.mechanobio.info/ Recruitment of the Arp2/3 complex to vinculin: coupling membrane protrusion to matrix adhesion. Recruitment of the Arp2/3 complex to vinculin: coupling membrane protrusion to matrix adhesion. J. Cell Biol. (0021-9525) 2002 imex curation DeMali K.A., Barlow C.A., Burridge K. The pull down assays between vinculin and the Arp2/3 complex, involving crude platelet extracts [Figs 6B, 6C, 6D(of p34)] could not be curated since the source of the platelets could not be identified. kdemali@med.unc.edu 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions human-hs68 Homo sapiens Hs68 normal diploid foreskin fibroblasts hs68 Human Hs68 normal diploid foreskin fibroblasts anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot DeMali K.A., Barlow C.A., Burridge K. The Hs68 cells were allowed to spread on Fibronectin-coated coverslips by centrifuging the cells onto the coverslips, followed by lysis of the cells and immunoprecipitation of vinculin. The pull down assays between vinculin and the Arp2/3 complex, involving crude platelet extracts [Figs 6B, 6C, 6D(of p34)] could not be curated since the source of the platelets could not be identified. kdemali@med.unc.edu Accepted 2013-MAY-17 by MGT 17-Jun-2013: Contacted by IntAct-Help. J. Cell Biol. (0021-9525) 2002 Only protein-protein interactions imex curation Recruitment of the Arp2/3 complex to vinculin: coupling membrane protrusion to matrix adhesion. Recruitment of the Arp2/3 complex to vinculin: coupling membrane protrusion to matrix adhesion. J. Cell Biol. (0021-9525) 2002 imex curation DeMali K.A., Barlow C.A., Burridge K. The pull down assays between vinculin and the Arp2/3 complex, involving crude platelet extracts [Figs 6B, 6C, 6D(of p34)] could not be curated since the source of the platelets could not be identified. kdemali@med.unc.edu 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions human-a_431 Homo sapiens epidermoid carcinoma a_431 Human epidermoid carcinoma anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot DeMali K.A., Barlow C.A., Burridge K. The pull down assays between vinculin and the Arp2/3 complex, involving crude platelet extracts [Figs 6B, 6C, 6D(of p34)] could not be curated since the source of the platelets could not be identified. The pull down assays between vinculin and the Arp2/3 complex, involving crude platelet extracts [Figs 6B, 6C, 6D(of p34)] could not be curated since the source of the platelets could not be identified. kdemali@med.unc.edu Accepted 2013-MAY-17 by MGT 17-Jun-2013: Contacted by IntAct-Help. J. Cell Biol. (0021-9525) 2002 Only protein-protein interactions imex curation Recruitment of the Arp2/3 complex to vinculin: coupling membrane protrusion to matrix adhesion. Recruitment of the Arp2/3 complex to vinculin: coupling membrane protrusion to matrix adhesion. J. Cell Biol. (0021-9525) 2002 imex curation DeMali K.A., Barlow C.A., Burridge K. The pull down assays between vinculin and the Arp2/3 complex, involving crude platelet extracts [Figs 6B, 6C, 6D(of p34)] could not be curated since the source of the platelets could not be identified. kdemali@med.unc.edu 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions mouse-embryonic_fibroblast Mus musculus embryonic fibroblasts embryonic_fibroblast Embryonic fibroblast Fibroblasts taken from an embryonic as opposed to a foetal or adult source. Foetus is defined as the stage at which tissue diferentiation is initiated. Tissue taken from an embryonic as opposed to a foetal or adult source. Embryo is defined as the development stage prior to organ formation. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot DeMali K.A., Barlow C.A., Burridge K. The pull down assays between vinculin and the Arp2/3 complex, involving crude platelet extracts [Figs 6B, 6C, 6D(of p34)] could not be curated since the source of the platelets could not be identified. kdemali@med.unc.edu Accepted 2013-MAY-17 by MGT 17-Jun-2013: Contacted by IntAct-Help. J. Cell Biol. (0021-9525) 2002 Only protein-protein interactions imex curation Recruitment of the Arp2/3 complex to vinculin: coupling membrane protrusion to matrix adhesion. Recruitment of the Arp2/3 complex to vinculin: coupling membrane protrusion to matrix adhesion. J. Cell Biol. (0021-9525) 2002 imex curation DeMali K.A., Barlow C.A., Burridge K. The pull down assays between vinculin and the Arp2/3 complex, involving crude platelet extracts [Figs 6B, 6C, 6D(of p34)] could not be curated since the source of the platelets could not be identified. kdemali@med.unc.edu 17-Jun-2013: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot DeMali K.A., Barlow C.A., Burridge K. The pull down assays between vinculin and the Arp2/3 complex, involving crude platelet extracts [Figs 6B, 6C, 6D(of p34)] could not be curated since the source of the platelets could not be identified. kdemali@med.unc.edu Accepted 2013-MAY-17 by MGT 17-Jun-2013: Contacted by IntAct-Help. J. Cell Biol. (0021-9525) 2002 Only protein-protein interactions imex curation vinex_mouse Vinexin Sorbs3 Scam1 Sh3d4 SH3 domain-containing protein SH3P3 SH3-containing adapter molecule 1 Sorbin and SH3 domain-containing protein 3 protein protein mouse Mus musculus Mouse MARILGVGRSSASSLNNKEDNESDVALLSPKDPNRVHTKEQLAHPASSNLDPSMQGLPAGLSLDDFIPGHLRTHIGSSSRGTRVPVIRNGGSNTLNFQFHDPAPRTVCNGCPPPRRDGSLNPDPAWYQTWPGPGSRPSMSPKPPASQHAQNWSATWTKDSKRQDKRWVKYEGIGPVDESGMPIAPRSSVDSPRDWYRRMFQQIHRKMPDLQLDWTLEDPPKVVSARASSAEPRHLGTLQRPASRPGTTETSSGRNWNHSEETSRNTFNYNFRPSSSGLHPPNQVPRHREKVENVWTEDSWNQFLHELETGHKPKKPLVDDPVEKPAQPIEVLLERELAKLSAELDKDLRAIETRLPSPKNSQAPRRPLEQPGLEQQPSARLSSAWRPNSPHAPYFSSSRPLSPHRMADGGGSPFLGRRDFVYPSSAREPSASERGSSPSRKEEKKRKAARLKFDFQAQSPKELSLQKGDIVYIHKEVDKNWLEGEHHGRLGIFPANYVEVLPADEIPKPIKPPTYQVLEYGDAVAQYTFKGDLEVELSFRKGERICLIRKVNEHWYEGRITGTGRQGIFPASYVQINREPRLRLCDDGPQLPASPNPTTTAHLSSHSHPSSIPVDPTDWGGRTSPRRSAFPFPITLQEPRSQTQSLNTPGPTLSHPRATSRPINLGPSSPNTEIHWTPYRAMYQYRPQNEDELELREGDRVDVMQQCDDGWFVGVSRRTQKFGTFPGNYVAPV D7716FA1D4F0E3CE ponsin_canfa_protein Ponsin protein protein canlf Canis familiaris (dog) Canis lupus familiaris Dog Canis familiaris arpc2_human Actin-related protein 2/3 complex subunit 2 ARPC2 ARC34 PRO2446 Arp2/3 complex 34 kDa subunit protein protein human Homo sapiens Human MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR DIP protein O15144 original sequence version: 99 DIP protein O15144 original sequence version: 122 DIP protein O15144 original sequence version: 119 DIP protein O15144 original sequence version: 140 3BA57121BE9A05F2 arpc2_mouse Actin-related protein 2/3 complex subunit 2 Arp2/3 complex 34 kDa subunit Arpc2 protein protein mouse Mus musculus Mouse MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPEPGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNATARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR 6A5D8500D641DB60 p12003-1 Vinculin Vinculin VCL VINC1 Metavinculin protein protein chick Gallus gallus (Chicken) Chicken MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNTKSQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAWASKDTEAMKRALALIDSKMNQAKGWLRDPNAPPGDAGEQAIRQILDEAGKAGELCAGKERREILGTCKTLGQMTDQLADLRARGQGATPMAMQKAQQVSQGLDLLTAKVENAARKLEAMTNSKQAIAKKIDAAQNWLADPNGGSEGEEHIRGIMSEARKVAELCEEPKERDDILRSLGEISALTAKLSDLRRHGKGDSPEARALAKQIATSLQNLQSKTNRAVANTRPVKAAVHLEGKIEQAQRWIDNPTVDDRGVGQAAIRGLVAEGRRLANVMMGPYRQDLLAKCDRVDQLAAQLADLAARGEGESPQARAIAAQLQDSLKDLKARMQEAMTQEVSDVFSDTTTPIKLLAVAATAPSDTPNREEVFEERAANFENHAARLGATAEKAAAVGTANKTTVEGIQATVKSARELTPQVVSAARILLRNPGNQAAYEHFETMKNQWIDNVEKMTGLVDEAIDTKSLLDASEEAIKKDLDKCKVAMANMQPQMLVAGATSIARRANRILLVAKREVENSEDPKFREAVKAASDELSKTISPMVMDAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEPDFPPPPPDLEHLHLTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEAINQPMMMAARQLHDEARKWSSKGNDIIAAAKRMALLMAEMSRLVRGGSGNKRALIQCAKDIAKASDEVTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTNISDEESEQATEMLVHNAQNLMQSVKETVREAEAASIKIRTDAGFTLRWVRKTPWYQ 6F585201260BA47F 6F585201260BA47F vinc_human Vinculin Metavinculin VCL protein protein human Homo sapiens Human MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAWASKDTEAMKRALASIDSKLNQAKGWLRDPSASPGDAGEQAIRQILDEAGKVGELCAGKERREILGTCKMLGQMTDQVADLRARGQGSSPVAMQKAQQVSQGLDVLTAKVENAARKLEAMTNSKQSIAKKIDAAQNWLADPNGGPEGEEQIRGALAEARKIAELCDDPKERDDILRSLGEISALTSKLADLRRQGKGDSPEARALAKQVATALQNLQTKTNRAVANSRPAKAAVHLEGKIEQAQRWIDNPTVDDRGVGQAAIRGLVAEGHRLANVMMGPYRQDLLAKCDRVDQLTAQLADLAARGEGESPQARALASQLQDSLKDLKARMQEAMTQEVSDVFSDTTTPIKLLAVAATAPPDAPNREEVFDERAANFENHSGKLGATAEKAAAVGTANKSTVEGIQASVKTARELTPQVVSAARILLRNPGNQAAYEHFETMKNQWIDNVEKMTGLVDEAIDTKSLLDASEEAIKKDLDKCKVAMANIQPQMLVAGATSIARRANRILLVAKREVENSEDPKFREAVKAASDELSKTISPMVMDAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEPDFPPPPPDLEQLRLTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEVINQPMMMAARQLHDEARKWSSKPGIPAAEVGIGVVAEADAADAAGFPVPPDMEDDYEPELLLMPSNQPVNQPILAAAQSLHREATKWSSKGNDIIAAAKRMALLMAEMSRLVRGGSGTKRALIQCAKDIAKASDEVTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTNISDEESEQATEMLVHNAQNLMQSVKETVREAEAASIKIRTDAGFTLRWVRKTPWYQ DIP protein P18206 original sequence version: 126 BFBD687DA836B0FA vasp_human Vasodilator-stimulated phosphoprotein VASP protein protein human Homo sapiens Human MSETVICSSRATVMLYDDGNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGRKMQPDQQVVINCAIVRGVKYNQATPNFHQWRDARQVWGLNFGSKEDAAQFAAGMASALEALEGGGPPPPPALPTWSVPNGPSPEEVEQQKRQQPGPSEHIERRVSNAGGPPAPPAGGPPPPPGPPPPPGPPPPPGLPPSGVPAAAHGAGGGPPPAPPLPAAQGPGGGGAGAPGLAAAIAGAKLRKVSKQEEASGGPTAPKAESGRSGGGGLMEEMNAMLARRRKATQVGEKTPKDESANQEEPEARVPAQSESVRRPWEKNSTTLPRMKSSSSVTTSETQPCTPSSSDYSDLQRVKQELLEEVKKELQKVKEEIIEAFVQELRKRGSP DIP protein P50552 original sequence version: 88 17634B8134DEBF59 vcl-arpc2-1 2 10 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Fig 1A, 2, 3A, 3B, 4. Vinculin interacted with the Arp2/3 complex only when the A431 cells were stimulated with EGF. The interaction was noticed 30 sec after EGF stimulation and decreased 15-20 min after the EGF stimulation (Fig 1A). Vinculin did not interact with the Arp2/3 complex in Wortmannin (PI3K inhibitor)-treated cells (Fig 2). Vinculin interacted with the Arp2/3 complex in the presence of constitutively active Rac (Fig 3B), but not in the presence of dominant negative Rac (Fig 3A). The interaction of vinculin with the Arp2/3 complex was slightly increased in the presence of PIP2, increased more in the presence of GST-VCA (of Wave protein) and was highest in the presence of both PIP2 and GST-VCA (Fig 4). vcl-arpc2-3 1 7 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Fig 1C. The interaction of vinculin with the Arp2/3 complex was low in stationary cells, but increased in cells allowed to spread on FN-coated coverslips. vcl-ponsin 4 6 unspecified role unspecified role prey prey canlf-mdck Canis familiaris (dog) kidney epithelial cells Canis lupus familiaris Dog Canis familiaris mdck Canine Cocker Spaniel kidney epithelial cell line 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Fig 6D (second panel). The vinculin [811-881] fragments with point mutations P876A and P878A also interacted with ponsin. vcl-sorbs3-1 4 9 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey mouse-c2c12 Mouse C3H muscle myoblast c2c12 Mouse C3H muscle myoblast physical association physical association Fig 6D (third panel). The vinculin [811-881] fragments with point mutations P876A and P878A also interacted with vinexin. vcl-vasp-4 4 11 unspecified role unspecified role prey prey human-a_431 Homo sapiens epidermoid carcinoma a_431 Human epidermoid carcinoma 9 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig 6D (fourth panel). The vinculin [811-881] fragments with point mutations P876A and P878A also interacted with VASP. vcl-arpc2-5 3 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait P12003-1:p.Pro878Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A Wed May 02 17:39:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro878ala' Tue Jun 30 19:18:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro878Ala' physical association physical association Fig 6E. Vinculin WT interacts with the Arp2/3 complex only in FBS-stimulated cells. Vinculin[P878A] did not interact with the Arp2/3 complex in the presence or absence of FBS stimulation. vcl-arpc2-7 4 7 unspecified role unspecified role prey prey human-platelet Homo sapiens platelet, thrombocytes platelet Platelet, thrombocyte 9 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig 7.