IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Mutant and wild-type alpha-synuclein interact with mitochondrial cytochrome C oxidase. Mutant and wild-type alpha-synuclein interact with mitochondrial cytochrome C oxidase. J. Mol. Neurosci. (0895-8696) 2002 imex curation Elkon H., Don J., Melamed E., Ziv I., Shirvan A., Offen D. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease Alzheimers - Interactions investigated in the context of Alzheimers disease doffen@post.tau.ac.il 13-Jan-2014: Contacted by IntAct-Help. Human adult brain cDNA expression library Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Elkon H., Don J., Melamed E., Ziv I., Shirvan A., Offen D. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. The positive control interaction could not be entered as both interactors could not be identified. doffen@post.tau.ac.il Accepted 2013-DEC-02 by PPORRAS Human adult brain cDNA expression library J. Mol. Neurosci. (0895-8696) 2002 Only protein-protein interactions imex curation Mutant and wild-type alpha-synuclein interact with mitochondrial cytochrome C oxidase. Mutant and wild-type alpha-synuclein interact with mitochondrial cytochrome C oxidase. J. Mol. Neurosci. (0895-8696) 2002 imex curation Elkon H., Don J., Melamed E., Ziv I., Shirvan A., Offen D. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease Alzheimers - Interactions investigated in the context of Alzheimers disease doffen@post.tau.ac.il 13-Jan-2014: Contacted by IntAct-Help. Human adult brain cDNA expression library Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Elkon H., Don J., Melamed E., Ziv I., Shirvan A., Offen D. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. doffen@post.tau.ac.il Accepted 2013-DEC-02 by PPORRAS Human adult brain cDNA expression library J. Mol. Neurosci. (0895-8696) 2002 Only protein-protein interactions imex curation Mutant and wild-type alpha-synuclein interact with mitochondrial cytochrome C oxidase. Mutant and wild-type alpha-synuclein interact with mitochondrial cytochrome C oxidase. J. Mol. Neurosci. (0895-8696) 2002 imex curation Elkon H., Don J., Melamed E., Ziv I., Shirvan A., Offen D. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease Alzheimers - Interactions investigated in the context of Alzheimers disease doffen@post.tau.ac.il 13-Jan-2014: Contacted by IntAct-Help. Human adult brain cDNA expression library Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Elkon H., Don J., Melamed E., Ziv I., Shirvan A., Offen D. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. doffen@post.tau.ac.il Accepted 2013-DEC-02 by PPORRAS Human adult brain cDNA expression library J. Mol. Neurosci. (0895-8696) 2002 Only protein-protein interactions imex curation cox3_human Cytochrome c oxidase subunit 3 MT-CO3 COIII COXIII MTCO3 Cytochrome c oxidase polypeptide III protein protein human Homo sapiens Human MTHQSHAYHMVKPSPWPLTGALSALLMTSGLAMWFHFHSMTLLMLGLLTNTLTMYQWWRDVTRESTYQGHHTPPVQKGLRYGMILFITSEVFFFAGFFWAFYHSSLAPTPQLGGHWPPTGITPLNPLEVPLLNTSVLLASGVSITWAHHSLMENNRNQMIQALLITILLGLYFTLLQASEYFESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSKHHFGFEAAAWYWHFVDVVWLFLYVSIYWWGS DIP protein P00414 original sequence version: null A04385EF748B7C14 syua_human Alpha-synuclein Non-A beta component of AD amyloid Non-A4 component of amyloid precursor SNCA NACP PARK1 protein protein human Homo sapiens Human MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA DIP protein P37840 original sequence version: 124 DIP protein P37840 original sequence version: 175 DIP protein P37840 original sequence version: 178 6BB2F12128931663 snca-mt_co3 3 4 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind range range range range 5 unspecified role unspecified role bait bait P37840:p.Ala53Thr mutation mutation certain certain sequence position certain certain certain sequence position certain A T Wed May 02 20:32:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala53thr' Tue Jun 30 16:41:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala53Thr' physical association physical association Figure 1 snca-mt_co3-1 1 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind range range range range physical association physical association Figure 2 Both wild type and mutant synuclein are stated to react with Mt-COX3 although it is not apparent from Fig 2 which form of synuclein was used. snca-mt_co3-2 2 5 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 4 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association Figure 3 Both wild type and mutant synuclein are stated to react with Mt-COX3 although it is not apparent from Fig 2 which form of synuclein was used.