UniProt UniProt http://www.uniprot.org CacyBP/SIP, a calcyclin and Siah-1-interacting protein, binds EF-hand proteins of the S100 family. CacyBP/SIP, a calcyclin and Siah-1-interacting protein, binds EF-hand proteins of the S100 family. J. Biol. Chem. (0021-9258) 2002 mimix curation Filipek A., Jastrzebska B., Nowotny M., Kuznicki J. Origin of CACYBP according pmid 10884380, of S100A1 and S100B accord. supplier (Sigma), of S100A6 accord. pimd 7584597, of S100P accord. pmid 1633809 (V. Gerke).Origin of S100A12 cannot be traced and respective interactions have been omitted. anfil@nencki.gov.pl 04-Feb-2013: Contacted by IntAct-Help. in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Filipek A., Jastrzebska B., Nowotny M., Kuznicki J. Origin of CACYBP according pmid 10884380, of S100A1 and S100B accord. supplier (Sigma), of S100A6 accord. pimd 7584597, of S100P accord. pmid 1633809 (V. Gerke).Origin of S100A12 cannot be traced and respective interactions have been omitted. anfil@nencki.gov.pl Accepted 2013-JAN-24 by MGT 04-Feb-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2002 mimix curation CacyBP/SIP, a calcyclin and Siah-1-interacting protein, binds EF-hand proteins of the S100 family. CacyBP/SIP, a calcyclin and Siah-1-interacting protein, binds EF-hand proteins of the S100 family. J. Biol. Chem. (0021-9258) 2002 mimix curation Filipek A., Jastrzebska B., Nowotny M., Kuznicki J. Origin of CACYBP according pmid 10884380, of S100A1 and S100B accord. supplier (Sigma), of S100A6 accord. pimd 7584597, of S100P accord. pmid 1633809 (V. Gerke).Origin of S100A12 cannot be traced and respective interactions have been omitted. anfil@nencki.gov.pl 04-Feb-2013: Contacted by IntAct-Help. in vitro In vitro affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom weight identificat confirmation by molecular weight weight identificat Filipek A., Jastrzebska B., Nowotny M., Kuznicki J. Altered to Direct Interaction- Mgt as all proteins have the same M.Wt so must have been assayed individually. Origin of CACYBP according pmid 10884380, of S100A1 and S100B accord. supplier (Sigma), of S100A6 accord. pimd 7584597, of S100P accord. pmid 1633809 (V. Gerke).Origin of S100A12 cannot be traced and respective interactions have been omitted. anfil@nencki.gov.pl Accepted 2013-JAN-24 by MGT 04-Feb-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2002 mimix curation CacyBP/SIP, a calcyclin and Siah-1-interacting protein, binds EF-hand proteins of the S100 family. CacyBP/SIP, a calcyclin and Siah-1-interacting protein, binds EF-hand proteins of the S100 family. J. Biol. Chem. (0021-9258) 2002 mimix curation Filipek A., Jastrzebska B., Nowotny M., Kuznicki J. Origin of CACYBP according pmid 10884380, of S100A1 and S100B accord. supplier (Sigma), of S100A6 accord. pimd 7584597, of S100P accord. pmid 1633809 (V. Gerke).Origin of S100A12 cannot be traced and respective interactions have been omitted. anfil@nencki.gov.pl 04-Feb-2013: Contacted by IntAct-Help. rat-brain Rattus norvegicus brain brain Brain [cerebrum] affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom western blot western blot Immuno blot Immuno blot Filipek A., Jastrzebska B., Nowotny M., Kuznicki J. Origin of CACYBP according pmid 10884380, of S100A1 and S100B accord. supplier (Sigma), of S100A6 accord. pimd 7584597, of S100P accord. pmid 1633809 (V. Gerke).Origin of S100A12 cannot be traced and respective interactions have been omitted. anfil@nencki.gov.pl Accepted 2013-JAN-24 by MGT 04-Feb-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2002 mimix curation CacyBP/SIP, a calcyclin and Siah-1-interacting protein, binds EF-hand proteins of the S100 family. CacyBP/SIP, a calcyclin and Siah-1-interacting protein, binds EF-hand proteins of the S100 family. J. Biol. Chem. (0021-9258) 2002 mimix curation Filipek A., Jastrzebska B., Nowotny M., Kuznicki J. Origin of CACYBP according pmid 10884380, of S100A1 and S100B accord. supplier (Sigma), of S100A6 accord. pimd 7584597, of S100P accord. pmid 1633809 (V. Gerke).Origin of S100A12 cannot be traced and respective interactions have been omitted. anfil@nencki.gov.pl 04-Feb-2013: Contacted by IntAct-Help. mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Filipek A., Jastrzebska B., Nowotny M., Kuznicki J. The host species and tissue has been tentatively assigned to mouse brain, details are not provided in the publication. Origin of CACYBP according pmid 10884380, of S100A1 and S100B accord. supplier (Sigma), of S100A6 accord. pimd 7584597, of S100P accord. pmid 1633809 (V. Gerke).Origin of S100A12 cannot be traced and respective interactions have been omitted. anfil@nencki.gov.pl Accepted 2013-JAN-24 by MGT 04-Feb-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2002 mimix curation CacyBP/SIP, a calcyclin and Siah-1-interacting protein, binds EF-hand proteins of the S100 family. CacyBP/SIP, a calcyclin and Siah-1-interacting protein, binds EF-hand proteins of the S100 family. J. Biol. Chem. (0021-9258) 2002 mimix curation Filipek A., Jastrzebska B., Nowotny M., Kuznicki J. Origin of CACYBP according pmid 10884380, of S100A1 and S100B accord. supplier (Sigma), of S100A6 accord. pimd 7584597, of S100P accord. pmid 1633809 (V. Gerke).Origin of S100A12 cannot be traced and respective interactions have been omitted. anfil@nencki.gov.pl 04-Feb-2013: Contacted by IntAct-Help. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Filipek A., Jastrzebska B., Nowotny M., Kuznicki J. Origin of CACYBP according pmid 10884380, of S100A1 and S100B accord. supplier (Sigma), of S100A6 accord. pimd 7584597, of S100P accord. pmid 1633809 (V. Gerke).Origin of S100A12 cannot be traced and respective interactions have been omitted. anfil@nencki.gov.pl Accepted 2013-JAN-24 by MGT 04-Feb-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2002 mimix curation CacyBP/SIP, a calcyclin and Siah-1-interacting protein, binds EF-hand proteins of the S100 family. CacyBP/SIP, a calcyclin and Siah-1-interacting protein, binds EF-hand proteins of the S100 family. J. Biol. Chem. (0021-9258) 2002 mimix curation Filipek A., Jastrzebska B., Nowotny M., Kuznicki J. Origin of CACYBP according pmid 10884380, of S100A1 and S100B accord. supplier (Sigma), of S100A6 accord. pimd 7584597, of S100P accord. pmid 1633809 (V. Gerke).Origin of S100A12 cannot be traced and respective interactions have been omitted. anfil@nencki.gov.pl 04-Feb-2013: Contacted by IntAct-Help. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Filipek A., Jastrzebska B., Nowotny M., Kuznicki J. Origin of CACYBP according pmid 10884380, of S100A1 and S100B accord. supplier (Sigma), of S100A6 accord. pimd 7584597, of S100P accord. pmid 1633809 (V. Gerke).Origin of S100A12 cannot be traced and respective interactions have been omitted. anfil@nencki.gov.pl Accepted 2013-JAN-24 by MGT 04-Feb-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2002 mimix curation CacyBP/SIP, a calcyclin and Siah-1-interacting protein, binds EF-hand proteins of the S100 family. CacyBP/SIP, a calcyclin and Siah-1-interacting protein, binds EF-hand proteins of the S100 family. J. Biol. Chem. (0021-9258) 2002 mimix curation Filipek A., Jastrzebska B., Nowotny M., Kuznicki J. Origin of CACYBP according pmid 10884380, of S100A1 and S100B accord. supplier (Sigma), of S100A6 accord. pimd 7584597, of S100P accord. pmid 1633809 (V. Gerke).Origin of S100A12 cannot be traced and respective interactions have been omitted. anfil@nencki.gov.pl 04-Feb-2013: Contacted by IntAct-Help. mouse Mus musculus Mouse anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Filipek A., Jastrzebska B., Nowotny M., Kuznicki J. Origin of CACYBP according pmid 10884380, of S100A1 and S100B accord. supplier (Sigma), of S100A6 accord. pimd 7584597, of S100P accord. pmid 1633809 (V. Gerke).Origin of S100A12 cannot be traced and respective interactions have been omitted. anfil@nencki.gov.pl Accepted 2013-JAN-24 by MGT 04-Feb-2013: Contacted by IntAct-Help. J. Biol. Chem. (0021-9258) 2002 mimix curation s100p_human Protein S100-P S100 calcium-binding protein P S100P S100E Protein S100-E Migration-inducing gene 9 protein protein protein human Homo sapiens Human MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK 786E6E3F3EACC6C1 s100b_bovin Protein S100-B S100B S100 calcium-binding protein B S-100 protein subunit beta S-100 protein beta chain protein protein bovin Bos taurus (Bovine) Bovine MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFEHE 589BF1DAA0AF6DA7 s100b_rat Protein S100-B S100b S100 calcium-binding protein B S-100 protein subunit beta S-100 protein beta chain protein protein rat Rattus norvegicus (Rat) Rat MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVSMVTTACHEFFEHE 43815AC212BEC7D0 s10a6_mouse Protein S100-A6 S100a6 Cacy 5B10 Calcyclin Prolactin receptor-associated protein S100 calcium-binding protein A6 protein protein mouse Mus musculus Mouse MACPLDQAIGLLVAIFHKYSGKEGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMDDLDRNKDQEVNFQEYVAFLGALALIYNEALK 2AA1A4018B8CA687 s100b_mouse Protein S100-B S100b S-100 protein beta chain S-100 protein subunit beta S100 calcium-binding protein B protein protein mouse Mus musculus Mouse MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVAMVTTACHEFFEHE 43815AC212A81DD0 cybp_mouse Calcyclin-binding protein Siah-interacting protein Cacybp Sip protein protein mouse Mus musculus Mouse MASVLEELQKDLEEVKVLLEKSTRKRLRDTLTSEKSKIETELKNKMQQKSQKKPELDNEKPAAVVAPLTTGYTVKISNYGWDQSDKFVKIYITLTGVHQVPTENVQVHFTERSFDLLVKNLNGKNYSMIVNNLLKPISVESSSKKVKTDTVIILCRKKAENTRWDYLTQVEKECKEKEKPSYDTEADPSEGLMNVLKKIYEDGDDDMKRTINKAWVESREKQAREDTEF 2B04B54D0054ACE0 s10a1_bovin Protein S100-A1 S100A1 S-100 protein alpha chain S-100 protein subunit alpha S100 calcium-binding protein A1 protein protein bovin Bos taurus (Bovine) Bovine MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDADAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS AD5E400DB85025D2 cacybp-cacybp 3 13 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 1 cacybp-s100a1 5 13 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey direct interaction direct interaction 2 cacybp-s100a6 5 13 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey direct interaction direct interaction 2 cacybp-s100b 5 13 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey direct interaction direct interaction 2 cacybp-s100p 5 8 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait direct interaction direct interaction 2 cacybp-cacybp-3 2 11 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait direct interaction direct interaction 3 cacybp-cacybp-2 2 14 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait direct interaction direct interaction 3 cacybp-cacybp-4 2 13 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey direct interaction direct interaction 3 cacybp-cacybp-1 2 13 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey direct interaction direct interaction 3 cacybp-cacybp-6 1 14 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component direct interaction direct interaction 4 cacybp-cacybp-5 1 9 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component direct interaction direct interaction 4 cacybp-cacybp-7 6 13 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey direct interaction direct interaction 5A cacybp-cacybp-8 6 13 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey direct interaction direct interaction 5A cacybp-cacybp-9 6 13 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey direct interaction direct interaction 5A s100b-s100b-5 4 13 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association 5B s100a6-cacybp-1 7 13 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association 5B