IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structure of an HIF-1alpha -pVHL complex: hydroxyproline recognition in signaling. Structure of an HIF-1alpha -pVHL complex: hydroxyproline recognition in signaling. Science (0036-8075) 2002 imex curation Min J.H., Yang H., Ivan M., Gertler F., Kaelin W.G., Pavletich N.P. Ranges for the regions of pVHL and elongin C were taken from PMID:10205047. nikola@xray2.mskcc.org 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Min J.H., Yang H., Ivan M., Gertler F., Kaelin W.G., Pavletich N.P. Hif1a peptides used in this experiment contain an additional asp residue at their termini to improve solubility. Ranges for the regions of pVHL and elongin C were taken from PMID:10205047. nikola@xray2.mskcc.org Accepted 2013-DEC-03 by PPORRAS Science (0036-8075) 2002 Only protein-protein interactions imex curation Structure of an HIF-1alpha -pVHL complex: hydroxyproline recognition in signaling. Structure of an HIF-1alpha -pVHL complex: hydroxyproline recognition in signaling. Science (0036-8075) 2002 imex curation Min J.H., Yang H., Ivan M., Gertler F., Kaelin W.G., Pavletich N.P. Ranges for the regions of pVHL and elongin C were taken from PMID:10205047. nikola@xray2.mskcc.org 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay predetermined predetermined participant predetermined Min J.H., Yang H., Ivan M., Gertler F., Kaelin W.G., Pavletich N.P. Ranges for the regions of pVHL and elongin C were taken from PMID:10205047. nikola@xray2.mskcc.org Accepted 2013-DEC-03 by PPORRAS Science (0036-8075) 2002 Only protein-protein interactions imex curation Structure of an HIF-1alpha -pVHL complex: hydroxyproline recognition in signaling. Structure of an HIF-1alpha -pVHL complex: hydroxyproline recognition in signaling. Science (0036-8075) 2002 imex curation Min J.H., Yang H., Ivan M., Gertler F., Kaelin W.G., Pavletich N.P. Ranges for the regions of pVHL and elongin C were taken from PMID:10205047. nikola@xray2.mskcc.org 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Min J.H., Yang H., Ivan M., Gertler F., Kaelin W.G., Pavletich N.P. Ranges for the regions of pVHL and elongin C were taken from PMID:10205047. nikola@xray2.mskcc.org Accepted 2013-DEC-03 by PPORRAS Science (0036-8075) 2002 Only protein-protein interactions imex curation vhl_human von Hippel-Lindau disease tumor suppressor VHL pVHL Protein G7 protein protein human Homo sapiens Human MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD DIP protein P40337 original sequence version: 176 DIP protein P40337 original sequence version: 103 DIP protein P40337-1 original sequence version: 177 DIP protein P40337 original sequence version: 160 DIP protein P40337 original sequence version: 175 BA5D6765FBC16EA7 eloc_human Elongin-C ELOC Elongin 15 kDa subunit RNA polymerase II transcription factor SIII subunit C SIII p15 TCEB1 Transcription elongation factor B polypeptide 1 protein protein human Homo sapiens Human MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC 98D88696E883538B hif1a_human Hypoxia-inducible factor 1-alpha ARNT-interacting protein Member of PAS protein 1 Basic-helix-loop-helix-PAS protein MOP1 HIF1A MOP1 BHLHE78 PASD8 PAS domain-containing protein 8 Class E basic helix-loop-helix protein 78 protein protein human Homo sapiens Human MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVMRLTISYLRVRKLLDAGDLDIEDDMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYMGLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGLVKKGKEQNTQRSFFLRMKCTLTSRGRTMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSKTFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQVTTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECVLKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTETDDQQLEEVPLYNDVMLPSPNEKLQNINLAMSPLPTAETPKPLRSSADPALNQEVALKLEPNPESLELSFTMPQIQDQTPSPSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKLFAEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTVTVFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKETTSATSSPYRDTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN DIP protein Q16665 original sequence version: 94 DIP protein Q16665 original sequence version: 98 DIP protein Q16665-1 original sequence version: 102 DIP protein Q16665 original sequence version: 102 DIP protein Q16665 original sequence version: 127 DIP protein Q16665 original sequence version: 120 DIP protein Q16665 original sequence version: 169 DIP protein Q16665 original sequence version: 174 DIP protein Q16665-1 original sequence version: 174 DIP protein Q16665-1 original sequence version: 191 DIP protein Q16665 original sequence version: 191 DIP protein Q16665 original sequence version: 179 DIP protein Q16665 original sequence version: 150 DIP protein Q16665 original sequence version: 156 DIP protein Q16665 original sequence version: 177 ABD4F7DAA135BE2D elob_human Elongin-B ELOB Elongin 18 kDa subunit RNA polymerase II transcription factor SIII subunit B SIII p18 TCEB2 Transcription elongation factor B polypeptide 2 protein protein human Homo sapiens Human MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ C045F58FBED0EC47 hif1a-tceb1-3 3 5 unspecified role unspecified role neutral component neutral component btb/poz_fold sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli 4 unspecified role unspecified role neutral component neutral component vhl_tumour_suppress_b/a_dom sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 6 unspecified role unspecified role neutral component neutral component deg_odph_vhl_1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain required hydroxypro-564 4hypro 4-hydroxy-L-proline (2S,4R)-4-hydroxypyrrolidine-2-carboxylic acid 4-hydroxy-L-proline 4-hydroxylated L-proline 4-hydroxyproline 4-trans-hydroxy-L-proline L-threo-4-hydroxyproline MOD_RES 4-hydroxyproline gamma-hydroxypyrrolidine-alpha-carboxylic acid 4HyPro certain certain sequence position certain certain certain sequence position certain hydroxylation of pro564 chemical synthesis Chemical synthesis (Chemical synthesis) 15 13 physical association physical association Fig. 1a, Fig. 2, Fig. 3, Table 1, Suppl. Fig. 1 1.85A working 19.6%, free 23.6% hif1a-tceb1-4 1 5 unspecified role unspecified role neutral component neutral component btb/poz_fold sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 4 unspecified role unspecified role neutral component neutral component vhl_tumour_suppress_b/a_dom sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 6 unspecified role unspecified role neutral component neutral component required hydroxypro-564 4hypro 4-hydroxy-L-proline (2S,4R)-4-hydroxypyrrolidine-2-carboxylic acid 4-hydroxy-L-proline 4-hydroxylated L-proline 4-hydroxyproline 4-trans-hydroxy-L-proline L-threo-4-hydroxyproline MOD_RES 4-hydroxyproline gamma-hydroxypyrrolidine-alpha-carboxylic acid 4HyPro certain certain sequence position certain certain certain sequence position certain hydroxylation of pro564 deg_odph_vhl_1 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli physical association physical association Table 2, Suppl. Fig. 3 Temp = 25C The full-length (residues 560-575) and N-terminal (residues 560-568) Hif1a peptides bound the VHL-elonginB/C complex with Kd = 0.22 +/- 0.04 x 10E-6 molar and Kd = 0.61 +/- 0.10 x 10E-6 molar, respectively. The C-terminal Hif1a peptide (residues 569-575) only bound at very high concentrations with Kd = 536 +/- 57 x 10E-6 molar. hif1a-tceb1-5 2 7 unspecified role unspecified role prey prey ecolx Escherichia coli 4 unspecified role unspecified role prey prey vhl_tumour_suppress_b/a_dom sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 5 unspecified role unspecified role prey prey btb/poz_fold sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 6 unspecified role unspecified role bait bait required hydroxypro-564 4hypro 4-hydroxy-L-proline (2S,4R)-4-hydroxypyrrolidine-2-carboxylic acid 4-hydroxy-L-proline 4-hydroxylated L-proline 4-hydroxyproline 4-trans-hydroxy-L-proline L-threo-4-hydroxyproline MOD_RES 4-hydroxyproline gamma-hydroxypyrrolidine-alpha-carboxylic acid 4HyPro certain certain sequence position certain certain certain sequence position certain hydroxylation of pro564 Q16665:p.Pro564Asp mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P D Wed May 02 19:47:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro564asp' Tue Jun 30 19:18:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro564Asp' Q16665:p.Pro564Gln mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P Q Wed May 02 15:43:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro564gln' Tue Jun 30 18:23:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro564Gln' Q16665:p.Pro564Glu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P E Wed May 02 16:58:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro564glu' Tue Jun 30 16:20:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro564Glu' Q16665:p.Pro564His mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P H Wed May 02 16:19:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro564his' Tue Jun 30 17:09:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro564His' Q16665:p.Pro564Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P A Wed May 02 19:00:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro564ala' Tue Jun 30 19:29:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro564Ala' Q16665:p.Pro564Met mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P M Wed May 02 20:12:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro564met' Tue Jun 30 19:19:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro564Met' Q16665:p.Pro564Trp mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P W Wed May 02 19:29:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro564trp' Tue Jun 30 19:43:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro564Trp' Q16665:p.Pro564Ile mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P I Wed May 02 15:18:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro564ile' Tue Jun 30 20:19:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro564Ile' Q16665:p.Pro564Lys mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P K Wed May 02 16:54:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro564lys' Tue Jun 30 17:48:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro564Lys' Q16665:p.Pro564Phe mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P F Wed May 02 16:28:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro564phe' Tue Jun 30 18:17:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro564Phe' deg_odph_vhl_1 required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Q16665:p.Pro564Gly mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P G Wed May 02 15:06:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro564gly' Tue Jun 30 17:03:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro564Gly' Q16665:p.Pro564Thr mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P T Wed May 02 15:33:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro564thr' Tue Jun 30 19:05:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro564Thr' Q16665:p.Pro564Cys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P C Wed May 02 15:31:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro564cys' Tue Jun 30 18:32:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro564Cys' Q16665:p.Pro564Val mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P V Wed May 02 17:35:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro564val' Tue Jun 30 16:12:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro564Val' Q16665:p.Pro564Leu mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P L Wed May 02 16:17:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro564leu' Tue Jun 30 19:34:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro564Leu' Q16665:p.Pro564Asn mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P N Wed May 02 19:17:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro564asn' Tue Jun 30 17:02:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro564Asn' Q16665:p.Pro564Ser mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P S Wed May 02 14:35:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro564ser' Tue Jun 30 15:59:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro564Ser' Q16665:p.Pro564Tyr mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain P Y Wed May 02 17:15:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro564tyr' Tue Jun 30 16:35:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro564Tyr' chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 4, Suppl. Fig. 4