I2D I2D Identification of sperm-specific proteins that interact with A-kinase anchoring proteins in a manner similar to the type II regulatory subunit of PKA. Identification of sperm-specific proteins that interact with A-kinase anchoring proteins in a manner similar to the type II regulatory subunit of PKA. J. Biol. Chem. (0021-9258) 2001 imex curation Carr D.W., Fujita A., Stentz C.L., Liberty G.A., Olson G.E., Narumiya S. carrd@ohsu.edu. 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Carr D.W., Fujita A., Stentz C.L., Liberty G.A., Olson G.E., Narumiya S. carrd@ohsu.edu. Accepted 2014-JAN-28 by ORCHARD pB42AD-fused human testis cDNA J. Biol. Chem. (0021-9258) 2001 imex curation Identification of sperm-specific proteins that interact with A-kinase anchoring proteins in a manner similar to the type II regulatory subunit of PKA. Identification of sperm-specific proteins that interact with A-kinase anchoring proteins in a manner similar to the type II regulatory subunit of PKA. J. Biol. Chem. (0021-9258) 2001 imex curation Carr D.W., Fujita A., Stentz C.L., Liberty G.A., Olson G.E., Narumiya S. carrd@ohsu.edu. 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Carr D.W., Fujita A., Stentz C.L., Liberty G.A., Olson G.E., Narumiya S. carrd@ohsu.edu. Accepted 2014-JAN-28 by ORCHARD J. Biol. Chem. (0021-9258) 2001 imex curation Identification of sperm-specific proteins that interact with A-kinase anchoring proteins in a manner similar to the type II regulatory subunit of PKA. Identification of sperm-specific proteins that interact with A-kinase anchoring proteins in a manner similar to the type II regulatory subunit of PKA. J. Biol. Chem. (0021-9258) 2001 imex curation Carr D.W., Fujita A., Stentz C.L., Liberty G.A., Olson G.E., Narumiya S. carrd@ohsu.edu. 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions mouse-spermatocyte Mus musculus spermatocyte Spermatocyte fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Carr D.W., Fujita A., Stentz C.L., Liberty G.A., Olson G.E., Narumiya S. carrd@ohsu.edu. Accepted 2014-JAN-28 by ORCHARD J. Biol. Chem. (0021-9258) 2001 imex curation kap2_human cAMP-dependent protein kinase type II-alpha regulatory subunit PKR2 PRKAR2 PRKAR2A protein protein human Homo sapiens Human MSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLGHPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDTDPRVIHPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQGEKADSFYIIESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSSVDLGNLGQ DIP protein P13861 original sequence version: 107 DIP protein P13861 original sequence version: 128 C7D6E8E476E1DB65 rop1b_human Ropporin-1B ROPN1B Rhophilin-associated protein 1B protein protein human Homo sapiens Human MAQTDKPTCIPPELPKMLKEFAKAAIRAQPQDLIQWGADYFEALSRGETPPVRERSERVALCNWAELTPELLKILHSQVAGRLIIRAEELAQMWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE 2867946D20C637AE akap3_human A-kinase anchor protein 3 AKAP3 AKAP110 SOB1 A-kinase anchor protein 110 kDa Cancer/testis antigen 82 Fibrous sheath protein of 95 kDa Fibrousheathin I Fibrousheathin-1 Protein kinase A-anchoring protein 3 Sperm oocyte-binding protein protein protein human Homo sapiens Human MSEKVDWLQSQNGVCKVDVYSPGDNQAQDWKMDTSTDPVRVLSWLRRDLEKSTAEFQDVRFKPGESFGGETSNSGDPHKGFSVDYYNTTTKGTPERLHFEMTHKEIPCQGPRAQLGNGSSVDEVSFYANRLTNLVIAMARKEINEKIDGSENKCVYQSLYMGNEPTPTKSLSKIASELVNETVSACSRNAAPDKAPGSGDRVSGSSQSPPNLKYKSTLKIKESTKERQGPDDKPPSKKSFFYKEVFESRNGDYAREGGRFFPRERKRFRGQERPDDFTASVSEGIMTYANSVVSDMMVSIMKTLKIQVKDTTIATILLKKVLLKHAKEVVSDLIDSFLRNLHSVTGTLMTDTQFVSAVKRTVFSHGSQKATDIMDAMLRKLYNVMFAKKVPEHVRKAQDKAESYSLISMKGMGDPKNRNVNFAMKSETKLREKMYSEPKSEEETCAKTLGEHIIKEGLTLWHKTQQKECKSLGFQHAAFEAPNTQRKPASDISFEYPEDIGNLSLPPYPPEKPENFMYDSDSWAEDLIVSALLLIQYHLAQGGRRDARSFVEAAGTTNFPANEPPVAPDESCLKSAPIVGDQEQAEKKDLRSVFFNFIRNLLSETIFKRDQSPEPKVPEQPVKEDRKLCERPLASSPPRLYEDDETPGALSGLTKMAVSQIDGHMSGQMVEHLMNSVMKLCVIIAKSCDASLAELGDDKSGDASRLTSAFPDSLYECLPAKGTGSAEAVLQNAYQAIHNEMRGTSGQPPEGCAAPTVIVSNHNLTDTVQNKQLQAVLQWVAASELNVPILYFAGDDEGIQEKLLQLSAAAVDKGCSVGEVLQSVLRYEKERQLNEAVGNVTPLQLLDWLMVNL CFDEA26922B5A86E rop1l_human Ropporin-1-like protein RSPH11 ROPN1L ASP AKAP-associated sperm protein protein protein human Homo sapiens Human MPLPDTMFCAQQIHIPPELPDILKQFTKAAIRTQPADVLRWSAGYFSALSRGDPLPVKDRMEMPTATQKTDTGLTQGLLKVLHKQCHHKRYVELTDLEQKWKNLCLPKEKFKALLQLDPCENKIKWINFLALGCSMLGGSLNTALKHLCEILTDDPEGGPARIPFKTFSYVYRYLARLDSDVSPLETESYLASLKENIDARKNGMIGLSDFFFPKRKLLESIENSEDVGH 5692E967769E8D45 rop1_mouse Ropporin-1 Ropn1 Rhophilin-associated protein 1 Rhophilin-associated 'oppo' protein protein protein mouse Mus musculus Mouse MPQTDKQVCIPPELPELLKQFTKDAIRTQPPDLIQWAAEYFGAMSRGEIPPVRERSEQIPLSNWAELTPELLKVLHSRVAGRLIIHADELAQMWKVLNLPTDLFNSVMNVGRFTEEIEWLKFLALACSSLGVTIAKTLKIVCEVLSSDHDGGPPRIPFSTFQFLYTYIAEVDGEISSSHVSRMLNYIEQEVIGPDGLIKVNDFTQNPRVRLE mint 782EA4C6890BC50C akap3_mouse A-kinase anchor protein 3 Akap3 Akap110 A-kinase anchor protein 110 kDa Protein kinase A-anchoring protein 3 protein protein mouse Mus musculus Mouse MADRVDWLQSQSGVCKVGVYSPGDNQHQDWKMDTSTDPVRVLSWLRKDLEKSTAGFQDSRFKPGESSFVEEVAYPVDQRKGFCVDYYNTTNKGSPGRLHFEMSHKENPSQGLISHVGNGGSIDEVSFYANRLTNLVIAMARKEINEKIHGAENKCVHQSLYMGDEPTPHKSLSTVASELVNETVTACSKNISSDKAPGSGDRASGSSQAPGLRYTSTLKIKESTKEGKCPDDKPGTKKSFFYKEVFESRNAGDAKEGGRSLPGDQKLFRTSPDNRPDDFSNSISQGIMTYANSVVSDMMVSIMKTLKIQVKDTTIATILLKKVLMKHAKEVVSDLIDSFMKNLHGVTGSLMTDTDFVSAVKRSFFSHGSQKATDIMDAMLGKLYNVMFAKKFPENIRRARDKSESYSLISTKSRAGDPKLSNLNFAMKSESKLKENLFSTCKLEKEKTCAETLGEHIIKEGLHMWHKSQQKSPGLERAAKLGNAPQEVSFECPDPCEANPPHQPQPPENFANFMCDSDSWAKDLIVSALLLIQYHLAQGGKMDAQSFLEAAASTNFPTNKPPPPSPVVQDECKLKSPPHKICDQEQTEKKDLMSVIFNFIRNLLSETIFKSSRNCESNVHEQNTQEEEIHPCERPKTPCERPITPPAPKFCEDEEATGGALSGLTKMVANQLDNCMNGQMVEHLMDSVMKLCLIIAKSCDSPLSELGEEKCGDASRPNSAFPDNLYECLPVKGTGTAEALLQNAYLTIHNELRGLSGQPPEGCEIPKVIVSNHNLADTVQNKQLQAVLQWVAASELNVPILYFAGDDEGIQEKLLQLSATAVEKGRSVGEVLQSVLRYEKERQLDEAVGNVTRLQLLDWLMANL 3E24E63327BC4E78 akap3-1 1 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain yeast Saccharomyces cerevisiae Baker's yeast 5 unspecified role unspecified role prey prey yeast Saccharomyces cerevisiae Baker's yeast physical association physical association fig 1 akap3-ropn1l-1 1 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain physical association physical association fig 1 akap3-prkar2a-1 1 4 unspecified role unspecified role prey prey yeast Saccharomyces cerevisiae Baker's yeast 6 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain yeast Saccharomyces cerevisiae Baker's yeast physical association physical association Fig 1 akap3-ropn1b 2 5 unspecified role unspecified role prey prey histag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag western blot western blot Immuno blot Immuno blot n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q9BZX4:p.Leu18Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain L A Wed May 02 18:40:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu18ala' Tue Jun 30 17:48:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu18Ala' ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag western blot western blot Immuno blot Immuno blot n-term range n-terminal range n-term range n-term range n-terminal range n-term range O75969:p.Leu131Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain L P Wed May 02 19:09:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu131pro' Tue Jun 30 18:03:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu131Pro' ecoli Escherichia coli (strain K12) physical association physical association Fig 5 akap3-kap2-1 2 6 unspecified role unspecified role bait bait O75969:p.Leu131Pro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L P Wed May 02 18:17:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu131pro' Tue Jun 30 19:23:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu131Pro' gsttag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey P13861:p.Leu14Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L A Wed May 02 14:24:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu14ala' Tue Jun 30 18:43:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu14Ala' ecoli Escherichia coli (strain K12) physical association physical association Fig 5 akap3-ropn1-2 3 8 unspecified role unspecified role unspecified role unspecified role mouse-spermatocyte Mus musculus spermatocyte Spermatocyte 9 unspecified role unspecified role unspecified role unspecified role mouse-spermatocyte Mus musculus spermatocyte Spermatocyte colocalization colocalization