UniProt UniProt http://www.uniprot.org Detection of direct binding of human herpesvirus 8-encoded interleukin-6 (vIL-6) to both gp130 and IL-6 receptor (IL-6R) and identification of amino acid residues of vIL-6 important for IL-6R-dependent and -independent signaling. Detection of direct binding of human herpesvirus 8-encoded interleukin-6 (vIL-6) to both gp130 and IL-6 receptor (IL-6R) and identification of amino acid residues of vIL-6 important for IL-6R-dependent and -independent signaling. J. Virol. (0022-538X) 2001 mimix curation Li H., Wang H., Nicholas J. nichojo@welchlink.welch.jhu.edu 13-Jan-2014: Contacted by IntAct-Help. in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Li H., Wang H., Nicholas J. nichojo@welchlink.welch.jhu.edu Accepted 2013-DEC-13 by ORCHARD J. Virol. (0022-538X) 2001 mimix curation Detection of direct binding of human herpesvirus 8-encoded interleukin-6 (vIL-6) to both gp130 and IL-6 receptor (IL-6R) and identification of amino acid residues of vIL-6 important for IL-6R-dependent and -independent signaling. Detection of direct binding of human herpesvirus 8-encoded interleukin-6 (vIL-6) to both gp130 and IL-6 receptor (IL-6R) and identification of amino acid residues of vIL-6 important for IL-6R-dependent and -independent signaling. J. Virol. (0022-538X) 2001 mimix curation Li H., Wang H., Nicholas J. nichojo@welchlink.welch.jhu.edu 13-Jan-2014: Contacted by IntAct-Help. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Li H., Wang H., Nicholas J. nichojo@welchlink.welch.jhu.edu Accepted 2013-DEC-13 by ORCHARD J. Virol. (0022-538X) 2001 mimix curation il6_human Interleukin-6 B-cell stimulatory factor 2 Interferon beta-2 Hybridoma growth factor CTL differentiation factor IL6 IFNB2 protein protein human Homo sapiens Human MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM 1F1ED1FE1B734079 il6ra_human Interleukin-6 receptor subunit alpha IL6R IL-6R 1 Membrane glycoprotein 80 protein protein human Homo sapiens Human MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR 62AA239FA14F1B8B il6rb_human Interleukin-6 receptor subunit beta IL6ST Interleukin-6 signal transducer Membrane glycoprotein 130 CDw130 Oncostatin-M receptor subunit alpha protein protein human Homo sapiens Human MLTLQTWLVQALFIFLTTESTGELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIISGLPPEKPKNLSCIVNEGKKMRCEWDGGRETHLETNFTLKSEWATHKFADCKAKRDTPTSCTVDYSTVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKPNPPHNLSVINSEELSSILKLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIRCMKEDGKGYWSDWSEEASGITYEDRPSKAPSFWYKIDPSHTQGYRTVQLVWKTLPPFEANGKILDYEVTLTRWKSHLQNYTVNATKLTVNLTNDRYLATLTVRNLVGKSDAAVLTIPACDFQATHPVMDLKAFPKDNMLWVEWTTPRESVKKYILEWCVLSDKAPCITDWQQEDGTVHRTYLRGNLAESKCYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWDQLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGGKDGPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKKHIWPNVPDPSKSHIAQWSPHTPPRHNFNSKDQMYSDGNFTDVSVVEIEANDKKPFPEDLKSLDLFKKEKINTEGHSSGIGGSSCMSSSRPSISSSDENESSQNTSSTVQYSTVVHSGYRHQVPSVQVFSRSESTQPLLDSEERPEDLQLVDHVDGGDGILPRQQYFKQNCSQHESSPDISHFERSKQVSSVNEEDFVRLKQQISDHISQSCGSGQMKMFQEVSAADAFGPGTEGQVERFETVGMEAATDEGMPKSYLPQTVRQGGYMPQ 6510A4409FFCF08C vil6_hhv8p Viral interleukin-6 homolog K2 protein protein hhv8p Human herpesvirus 8 Kaposi's sarcoma-associated herpesvirus HHV-8 MRWFKLWSILLVGSLLVSGTRGKLPDAPEFEKDLLIQRLNWMLWVIDECFRDLCYRTGICKGILEPAAIFHLKLPAINDTDHCGLIGFNETSCLKKLADGFFEFEVLFKFLTTEFGKSVINVDVMELLTKTLGWDIQEELNKLTKTHYSPPKFDRGLLGRLQGLKYWVRHFASFYVLSAMEKFAGQAVRVLNSIPDVTPDVHDK 722A16644C6835A5 il6st-k2 1 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait direct interaction direct interaction 2A il6r-k2-2 1 4 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey direct interaction direct interaction 2A il6r-il6-1 1 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait direct interaction direct interaction 2A il6r-k2-1 2 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association 2B il6st-k2-1 2 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 2B and 5A and B il6r-il6st 2 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey association association 2B il6r-il6-1 2 4 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association 2B il6r-il6-1 2 5 unspecified role unspecified role prey prey 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait association association 2B il6-il6r-2 2 4 unspecified role unspecified role unspecified role unspecified role 3 unspecified role unspecified role unspecified role unspecified role physical association physical association 2B