UniProt UniProt http://www.uniprot.org The leucine zipper of NRL interacts with the CRX homeodomain. A possible mechanism of transcriptional synergy in rhodopsin regulation. The leucine zipper of NRL interacts with the CRX homeodomain. A possible mechanism of transcriptional synergy in rhodopsin regulation. J. Biol. Chem. (0021-9258) 2000 imex curation Mitton K.P., Swain P.K., Chen S., Xu S., Zack D.J., Swaroop A. Interacions c-jun : c-fos (positive control, fig.3c) omitted as origin of proteins cannot be esatablished swaroop@umich.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Mitton K.P., Swain P.K., Chen S., Xu S., Zack D.J., Swaroop A. Interacions c-jun : c-fos (positive control, fig.3c) omitted as origin of proteins cannot be esatablished swaroop@umich.edu Accepted 2013-NOV-26 by MGT J. Biol. Chem. (0021-9258) 2000 Only protein-protein interactions imex curation The leucine zipper of NRL interacts with the CRX homeodomain. A possible mechanism of transcriptional synergy in rhodopsin regulation. The leucine zipper of NRL interacts with the CRX homeodomain. A possible mechanism of transcriptional synergy in rhodopsin regulation. J. Biol. Chem. (0021-9258) 2000 imex curation Mitton K.P., Swain P.K., Chen S., Xu S., Zack D.J., Swaroop A. Interacions c-jun : c-fos (positive control, fig.3c) omitted as origin of proteins cannot be esatablished swaroop@umich.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Mitton K.P., Swain P.K., Chen S., Xu S., Zack D.J., Swaroop A. Interacions c-jun : c-fos (positive control, fig.3c) omitted as origin of proteins cannot be esatablished swaroop@umich.edu Accepted 2013-NOV-26 by MGT bovine retina cDNA J. Biol. Chem. (0021-9258) 2000 Only protein-protein interactions imex curation The leucine zipper of NRL interacts with the CRX homeodomain. A possible mechanism of transcriptional synergy in rhodopsin regulation. The leucine zipper of NRL interacts with the CRX homeodomain. A possible mechanism of transcriptional synergy in rhodopsin regulation. J. Biol. Chem. (0021-9258) 2000 imex curation Mitton K.P., Swain P.K., Chen S., Xu S., Zack D.J., Swaroop A. Interacions c-jun : c-fos (positive control, fig.3c) omitted as origin of proteins cannot be esatablished swaroop@umich.edu 13-Jan-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Mitton K.P., Swain P.K., Chen S., Xu S., Zack D.J., Swaroop A. Interacions c-jun : c-fos (positive control, fig.3c) omitted as origin of proteins cannot be esatablished swaroop@umich.edu Accepted 2013-NOV-26 by MGT J. Biol. Chem. (0021-9258) 2000 Only protein-protein interactions imex curation nrl_human Neural retina-specific leucine zipper protein NRL D14S46E protein protein human Homo sapiens Human MALPPSPLAMEYVNDFDLMKFEVKREPSEGRPGPPTASLGSTPYSSVPPSPTFSEPGMVGATEGTRPGLEELYWLATLQQQLGAGEALGLSPEEAMELLQGQGPVPVDGPHGYYPGSPEETGAQHVQLAERFSDAALVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQRRGLEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSSGPGSGDPSHLFL CCABEDC1C1123614 crx_bovin Cone-rod homeobox protein CRX protein protein bovin Bos taurus (Bovine) Bovine MMAYMNPGPHYSVNALALSGPSVDLMHPAVSYPSAPRKQRRERTTFTRSQLEELEALFAKTQYPDVYAREEVALKINLPESRVQVWFKNRRAKCRQQRQQQKQQQQPPGAQAKARPAKRKAGTSPRSSTDVCPDPLGISDSYSPPLPGPSGSPTTAVATVSIWSPASESPLPEAQRAGLVASGPSLTSAPYAMTYAPASAFCSSPSAYGSPSSYFSGLDPYLSPMVPPLGGPALSPLSGPSVGPSLTQSPTSLSGQSYGTYSPVDSLEFKDPTGTWKFTYNPMDPLDYKDQSAWKFQIL 512ED6A6DAFBAC19 nrl-crx 2 5 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range 4 unspecified role unspecified role bait bait bzip sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 2 nrl-crx-1 1 5 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range 4 unspecified role unspecified role bait bait bzip sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 3 nrl-crx-2 3 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain range range in vitro In vitro physical association physical association 4 and 5 crx-nrl 3 5 unspecified role unspecified role bait bait n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro physical association physical association 6 Removal of the leucine zipper domain decreased NRL's binding to CRX-HD. nrl-crx-3 3 5 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9XSK0:p.Arg41Trp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain R W Wed May 02 16:42:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg41trp' Tue Jun 30 18:23:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg41Trp' Q9XSK0:p.Arg90Trp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain R W Wed May 02 14:44:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg90trp' Tue Jun 30 17:52:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg90Trp' in vitro In vitro 4 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n_terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 7