bhf-ucl Interaction of plakophilins with desmoplakin and intermediate filament proteins: an in vitro analysis. Interaction of plakophilins with desmoplakin and intermediate filament proteins: an in vitro analysis. J. Cell. Sci. (0021-9533) 2000 imex curation Hofmann I., Mertens C., Brettel M., Nimmrich V., Schnölzer M., Herrmann H. Cardiac - Interactions involving cardiac related proteins protein purification mostly by inclusion body preps, eg Coulombe PA, Fuchs E.1990 Accession for PKP1a Z34974, encodes isoform 1,Q13835-2, which is missing 412-432 compared to isoform 2 cDNAs coding for the complete CK5 and CK14, respectively, were isolated from a human epidermis cDNA library (Clontech, Palo Alto, CA, USA; 5'-Stretch Plus, HL 1112b) using 32P-labelled partial clones of human CK5 and 14. For expression of complete human PKP1a (accession number Z34974) in Escherichia coli. Methods confirm human vimentin , mouse desmin, total CK8 and CK18. Fig 1 schematic drawing suggests PKP2a is human. Hofmann I, Franke WW 1997 ref PMID: 9157008 abstract states: We have determined relative affinities of type I and type II human non-epidermal cytokeratin (CK) polypeptides synthesized in Escherichia coli from cDNA, therefore annotated CK14, CK8, CK18, CK8 rod and CK18 rod as human as these were prepared as described (Coulombe and Fuchs, 1990; Hofmann and Franke, 1997, all of which describe human proteins Hofmann author of this paper and reference. i.hofmann@dkfz-heidelberg.de 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Hofmann I., Mertens C., Brettel M., Nimmrich V., Schnölzer M., Herrmann H. Cardiac - Interactions involving cardiac related proteins protein purification mostly by inclusion body preps, eg Coulombe PA, Fuchs E.1990 Accession for PKP1a Z34974, encodes isoform 1,Q13835-2, which is missing 412-432 compared to isoform 2 i.hofmann@dkfz-heidelberg.de Accepted 2014-JAN-27 by ORCHARD Surface plasmon resonance detection J. Cell. Sci. (0021-9533) 2000 imex curation Interaction of plakophilins with desmoplakin and intermediate filament proteins: an in vitro analysis. Interaction of plakophilins with desmoplakin and intermediate filament proteins: an in vitro analysis. J. Cell. Sci. (0021-9533) 2000 imex curation Hofmann I., Mertens C., Brettel M., Nimmrich V., Schnölzer M., Herrmann H. Cardiac - Interactions involving cardiac related proteins protein purification mostly by inclusion body preps, eg Coulombe PA, Fuchs E.1990 Accession for PKP1a Z34974, encodes isoform 1,Q13835-2, which is missing 412-432 compared to isoform 2 cDNAs coding for the complete CK5 and CK14, respectively, were isolated from a human epidermis cDNA library (Clontech, Palo Alto, CA, USA; 5'-Stretch Plus, HL 1112b) using 32P-labelled partial clones of human CK5 and 14. For expression of complete human PKP1a (accession number Z34974) in Escherichia coli. Methods confirm human vimentin , mouse desmin, total CK8 and CK18. Fig 1 schematic drawing suggests PKP2a is human. Hofmann I, Franke WW 1997 ref PMID: 9157008 abstract states: We have determined relative affinities of type I and type II human non-epidermal cytokeratin (CK) polypeptides synthesized in Escherichia coli from cDNA, therefore annotated CK14, CK8, CK18, CK8 rod and CK18 rod as human as these were prepared as described (Coulombe and Fuchs, 1990; Hofmann and Franke, 1997, all of which describe human proteins Hofmann author of this paper and reference. i.hofmann@dkfz-heidelberg.de 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting autoradiography autoradiography Hofmann I., Mertens C., Brettel M., Nimmrich V., Schnölzer M., Herrmann H. Cardiac - Interactions involving cardiac related proteins protein purification mostly by inclusion body preps, eg Coulombe PA, Fuchs E.1990 Accession for PKP1a Z34974, encodes isoform 1,Q13835-2, which is missing 412-432 compared to isoform 2 Accession for PKP1a Z34974, encodes isoform 1,Q13835-2, which is missing 412-432 compared to isoform 2 i.hofmann@dkfz-heidelberg.de Accepted 2014-JAN-27 by ORCHARD J. Cell. Sci. (0021-9533) 2000 imex curation Interaction of plakophilins with desmoplakin and intermediate filament proteins: an in vitro analysis. Interaction of plakophilins with desmoplakin and intermediate filament proteins: an in vitro analysis. J. Cell. Sci. (0021-9533) 2000 imex curation Hofmann I., Mertens C., Brettel M., Nimmrich V., Schnölzer M., Herrmann H. Cardiac - Interactions involving cardiac related proteins protein purification mostly by inclusion body preps, eg Coulombe PA, Fuchs E.1990 Accession for PKP1a Z34974, encodes isoform 1,Q13835-2, which is missing 412-432 compared to isoform 2 cDNAs coding for the complete CK5 and CK14, respectively, were isolated from a human epidermis cDNA library (Clontech, Palo Alto, CA, USA; 5'-Stretch Plus, HL 1112b) using 32P-labelled partial clones of human CK5 and 14. For expression of complete human PKP1a (accession number Z34974) in Escherichia coli. Methods confirm human vimentin , mouse desmin, total CK8 and CK18. Fig 1 schematic drawing suggests PKP2a is human. Hofmann I, Franke WW 1997 ref PMID: 9157008 abstract states: We have determined relative affinities of type I and type II human non-epidermal cytokeratin (CK) polypeptides synthesized in Escherichia coli from cDNA, therefore annotated CK14, CK8, CK18, CK8 rod and CK18 rod as human as these were prepared as described (Coulombe and Fuchs, 1990; Hofmann and Franke, 1997, all of which describe human proteins Hofmann author of this paper and reference. i.hofmann@dkfz-heidelberg.de 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hacat Homo sapiens immortalised keratinocytes hacat human immortalised keratinocytes anti bait coip anti bait coimmunoprecipitation anti bait coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence Hofmann I., Mertens C., Brettel M., Nimmrich V., Schnölzer M., Herrmann H. Cardiac - Interactions involving cardiac related proteins protein purification mostly by inclusion body preps, eg Coulombe PA, Fuchs E.1990 Accession for PKP1a Z34974, encodes isoform 1,Q13835-2, which is missing 412-432 compared to isoform 2 i.hofmann@dkfz-heidelberg.de Accepted 2014-JAN-27 by ORCHARD J. Cell. Sci. (0021-9533) 2000 imex curation Interaction of plakophilins with desmoplakin and intermediate filament proteins: an in vitro analysis. Interaction of plakophilins with desmoplakin and intermediate filament proteins: an in vitro analysis. J. Cell. Sci. (0021-9533) 2000 imex curation Hofmann I., Mertens C., Brettel M., Nimmrich V., Schnölzer M., Herrmann H. Cardiac - Interactions involving cardiac related proteins protein purification mostly by inclusion body preps, eg Coulombe PA, Fuchs E.1990 Accession for PKP1a Z34974, encodes isoform 1,Q13835-2, which is missing 412-432 compared to isoform 2 cDNAs coding for the complete CK5 and CK14, respectively, were isolated from a human epidermis cDNA library (Clontech, Palo Alto, CA, USA; 5'-Stretch Plus, HL 1112b) using 32P-labelled partial clones of human CK5 and 14. For expression of complete human PKP1a (accession number Z34974) in Escherichia coli. Methods confirm human vimentin , mouse desmin, total CK8 and CK18. Fig 1 schematic drawing suggests PKP2a is human. Hofmann I, Franke WW 1997 ref PMID: 9157008 abstract states: We have determined relative affinities of type I and type II human non-epidermal cytokeratin (CK) polypeptides synthesized in Escherichia coli from cDNA, therefore annotated CK14, CK8, CK18, CK8 rod and CK18 rod as human as these were prepared as described (Coulombe and Fuchs, 1990; Hofmann and Franke, 1997, all of which describe human proteins Hofmann author of this paper and reference. i.hofmann@dkfz-heidelberg.de 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Hofmann I., Mertens C., Brettel M., Nimmrich V., Schnölzer M., Herrmann H. Cardiac - Interactions involving cardiac related proteins protein purification mostly by inclusion body preps, eg Coulombe PA, Fuchs E.1990 Accession for PKP1a Z34974, encodes isoform 1,Q13835-2, which is missing 412-432 compared to isoform 2 Accession for PKP1a Z34974, encodes isoform 1,Q13835-2, which is missing 412-432 compared to isoform 2 i.hofmann@dkfz-heidelberg.de Accepted 2014-JAN-27 by ORCHARD J. Cell. Sci. (0021-9533) 2000 imex curation Interaction of plakophilins with desmoplakin and intermediate filament proteins: an in vitro analysis. Interaction of plakophilins with desmoplakin and intermediate filament proteins: an in vitro analysis. J. Cell. Sci. (0021-9533) 2000 imex curation Hofmann I., Mertens C., Brettel M., Nimmrich V., Schnölzer M., Herrmann H. Cardiac - Interactions involving cardiac related proteins protein purification mostly by inclusion body preps, eg Coulombe PA, Fuchs E.1990 Accession for PKP1a Z34974, encodes isoform 1,Q13835-2, which is missing 412-432 compared to isoform 2 cDNAs coding for the complete CK5 and CK14, respectively, were isolated from a human epidermis cDNA library (Clontech, Palo Alto, CA, USA; 5'-Stretch Plus, HL 1112b) using 32P-labelled partial clones of human CK5 and 14. For expression of complete human PKP1a (accession number Z34974) in Escherichia coli. Methods confirm human vimentin , mouse desmin, total CK8 and CK18. Fig 1 schematic drawing suggests PKP2a is human. Hofmann I, Franke WW 1997 ref PMID: 9157008 abstract states: We have determined relative affinities of type I and type II human non-epidermal cytokeratin (CK) polypeptides synthesized in Escherichia coli from cDNA, therefore annotated CK14, CK8, CK18, CK8 rod and CK18 rod as human as these were prepared as described (Coulombe and Fuchs, 1990; Hofmann and Franke, 1997, all of which describe human proteins Hofmann author of this paper and reference. i.hofmann@dkfz-heidelberg.de 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions human-hacat Homo sapiens immortalised keratinocytes hacat human immortalised keratinocytes anti bait coip anti bait coimmunoprecipitation anti bait coip monoclonal western monoclonal antibody western blot monoclonal western Hofmann I., Mertens C., Brettel M., Nimmrich V., Schnölzer M., Herrmann H. Cardiac - Interactions involving cardiac related proteins protein purification mostly by inclusion body preps, eg Coulombe PA, Fuchs E.1990 Accession for PKP1a Z34974, encodes isoform 1,Q13835-2, which is missing 412-432 compared to isoform 2 i.hofmann@dkfz-heidelberg.de Accepted 2014-JAN-27 by ORCHARD J. Cell. Sci. (0021-9533) 2000 imex curation desp_human Desmoplakin DSP 250/210 kDa paraneoplastic pemphigus antigen protein protein human Homo sapiens Human MSCNGGSHPRINTLGRMIRAESGPDLRYEVTSGGGGTSRMYYSRRGVITDQNSDGYCQTGTMSRHQNQNTIQELLQNCSDCLMRAELIVQPELKYGDGIQLTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSDKNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAYMDTLQTQWSWILQITKCIDVHLKENAAYFQFFEEAQSTEAYLKGLQDSIRKKYPCDKNMPLQHLLEQIKELEKEREKILEYKRQVQNLVNKSKKIVQLKPRNPDYRSNKPIILRALCDYKQDQKIVHKGDECILKDNNERSKWYVTGPGGVDMLVPSVGLIIPPPNPLAVDLSCKIEQYYEAILALWNQLYINMKSLVSWHYCMIDIEKIRAMTIAKLKTMRQEDYMKTIADLELHYQEFIRNSQGSEMFGDDDKRKIQSQFTDAQKHYQTLVIQLPGYPQHQTVTTTEITHHGTCQDVNHNKVIETNRENDKQETWMLMELQKIRRQIEHCEGRMTLKNLPLADQGSSHHITVKINELKSVQNDSQAIAEVLNQLKDMLANFRGSEKYCYLQNEVFGLFQKLENINGVTDGYLNSLCTVRALLQAILQTEDMLKVYEARLTEEETVCLDLDKVEAYRCGLKKIKNDLNLKKSLLATMKTELQKAQQIHSQTSQQYPLYDLDLGKFGEKVTQLTDRWQRIDKQIDFRLWDLEKQIKQLRNYRDNYQAFCKWLYDAKRRQDSLESMKFGDSNTVMRFLNEQKNLHSEISGKRDKSEEVQKIAELCANSIKDYELQLASYTSGLETLLNIPIKRTMIQSPSGVILQEAADVHARYIELLTRSGDYYRFLSEMLKSLEDLKLKNTKIEVLEEELRLARDANSENCNKNKFLDQNLQKYQAECSQFKAKLASLEELKRQAELDGKSAKQNLDKCYGQIKELNEKITRLTYEIEDEKRRRKSVEDRFDQQKNDYDQLQKARQCEKENLGWQKLESEKAIKEKEYEIERLRVLLQEEGTRKREYENELAKVRNHYNEEMSNLRNKYETEINITKTTIKEISMQKEDDSKNLRNQLDRLSRENRDLKDEIVRLNDSILQATEQRRRAEENALQQKACGSEIMQKKQHLEIELKQVMQQRSEDNARHKQSLEEAAKTIQDKNKEIERLKAEFQEEAKRRWEYENELSKVRNNYDEEIISLKNQFETEINITKTTIHQLTMQKEEDTSGYRAQIDNLTRENRSLSEEIKRLKNTLTQTTENLRRVEEDIQQQKATGSEVSQRKQQLEVELRQVTQMRTEESVRYKQSLDDAAKTIQDKNKEIERLKQLIDKETNDRKCLEDENARLQRVQYDLQKANSSATETINKLKVQEQELTRLRIDYERVSQERTVKDQDITRFQNSLKELQLQKQKVEEELNRLKRTASEDSCKRKKLEEELEGMRRSLKEQAIKITNLTQQLEQASIVKKRSEDDLRQQRDVLDGHLREKQRTQEELRRLSSEVEALRRQLLQEQESVKQAHLRNEHFQKAIEDKSRSLNESKIEIERLQSLTENLTKEHLMLEEELRNLRLEYDDLRRGRSEADSDKNATILELRSQLQISNNRTLELQGLINDLQRERENLRQEIEKFQKQALEASNRIQESKNQCTQVVQERESLLVKIKVLEQDKARLQRLEDELNRAKSTLEAETRVKQRLECEKQQIQNDLNQWKTQYSRKEEAIRKIESEREKSEREKNSLRSEIERLQAEIKRIEERCRRKLEDSTRETQSQLETERSRYQREIDKLRQRPYGSHRETQTECEWTVDTSKLVFDGLRKKVTAMQLYECQLIDKTTLDKLLKGKKSVEEVASEIQPFLRGAGSIAGASASPKEKYSLVEAKRKKLISPESTVMLLEAQAATGGIIDPHRNEKLTVDSAIARDLIDFDDRQQIYAAEKAITGFDDPFSGKTVSVSEAIKKNLIDRETGMRLLEAQIASGGVVDPVNSVFLPKDVALARGLIDRDLYRSLNDPRDSQKNFVDPVTKKKVSYVQLKERCRIEPHTGLLLLSVQKRSMSFQGIRQPVTVTELVDSGILRPSTVNELESGQISYDEVGERIKDFLQGSSCIAGIYNETTKQKLGIYEAMKIGLVRPGTALELLEAQAATGFIVDPVSNLRLPVEEAYKRGLVGIEFKEKLLSAERAVTGYNDPETGNIISLFQAMNKELIEKGHGIRLLEAQIATGGIIDPKESHRLPVDIAYKRGYFNEELSEILSDPSDDTKGFFDPNTEENLTYLQLKERCIKDEETGLCLLPLKEKKKQVQTSQKNTLRKRRVVIVDPETNKEMSVQEAYKKGLIDYETFKELCEQECEWEEITITGSDGSTRVVLVDRKTGSQYDIQDAIDKGLVDRKFFDQYRSGSLSLTQFADMISLKNGVGTSSSMGSGVSDDVFSSSRHESVSKISTISSVRNLTIRSSSFSDTLEESSPIAAIFDTENLEKISITEGIERGIVDSITGQRLLEAQACTGGIIHPTTGQKLSLQDAVSQGVIDQDMATRLKPAQKAFIGFEGVKGKKKMSAAEAVKEKWLPYEAGQRFLEFQYLTGGLVDPEVHGRISTEEAIRKGFIDGRAAQRLQDTSSYAKILTCPKTKLKISYKDAINRSMVEDITGLRLLEAASVSSKGLPSPYNMSSAPGSRSGSRSGSRSGSRSGSRSGSRRGSFDATGNSSYSYSYSFSSSSIGH DIP protein P15924 original sequence version: 137 5770CC6B4F9F9F7B vime_human Vimentin VIM protein protein human Homo sapiens Human MSTRSVSSSSYRRMFGGPGTASRPSSSRSYVTTSTRTYSLGSALRPSTSRSLYASSPGGVYATRSSAVRLRSSVPGVRLLQDSVDFSLADAINTEFKNTRTNEKVELQELNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRRQVDQLTNDKARVEVERDNLAEDIMRLREKLQEEMLQREEAENTLQSFRQDVDNASLARLDLERKVESLQEEIAFLKKLHEEEIQELQAQIQEQHVQIDVDVSKPDLTAALRDVRQQYESVAAKNLQEAEEWYKSKFADLSEAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSSLNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE DIP protein P08670 original sequence version: 195 DIP protein P08670 original sequence version: 209 DIP protein P08670 original sequence version: 192 DIP protein P08670 original sequence version: 175 BAB54026665B015A k1c14_human Keratin, type I cytoskeletal 14 Cytokeratin-14 KRT14 Keratin-14 protein protein human Homo sapiens Human MTTCSRQFTSSSSMKGSCGIGGGIGGGSSRISSVLAGGSCRAPSTYGGGLSVSSSRFSSGGACGLGGGYGGGFSSSSSSFGSGFGGGYGGGLGAGLGGGFGGGFAGGDGLLVGSEKVTMQNLNDRLASYLDKVRALEEANADLEVKIRDWYQRQRPAEIKDYSPYFKTIEDLRNKILTATVDNANVLLQIDNARLAADDFRTKYETELNLRMSVEADINGLRRVLDELTLARADLEMQIESLKEELAYLKKNHEEEMNALRGQVGGDVNVEMDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEEWFFTKTEELNREVATNSELVQSGKSEISELRRTMQNLEIELQSQLSMKASLENSLEETKGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN DIP protein P02533 original sequence version: 143 120BA30BA2F8E397 pkp2_human Plakophilin-2 PKP2 protein protein human Homo sapiens Human MAAPGAPAEYGYIRTVLGQQILGQLDSSSLALPSEAKLKLAGSSGRGGQTVKSLRIQEQVQQTLARKGRSSVGNGNLHRTSSVPEYVYNLHLVENDFVGGRSPVPKTYDMLKAGTTATYEGRWGRGTAQYSSQKSVEERSLRHPLRRLEISPDSSPERAHYTHSDYQYSQRSQAGHTLHHQESRRAALLVPPRYARSEIVGVSRAGTTSRQRHFDTYHRQYQHGSVSDTVFDSIPANPALLTYPRPGTSRSMGNLLEKENYLTAGLTVGQVRPLVPLQPVTQNRASRSSWHQSSFHSTRTLREAGPSVAVDSSGRRAHLTVGQAAAGGSGNLLTERSTFTDSQLGNADMEMTLERAVSMLEADHMLPSRISAAATFIQHECFQKSEARKRVNQLRGILKLLQLLKVQNEDVQRAVCGALRNLVFEDNDNKLEVAELNGVPRLLQVLKQTRDLETKKQITDHTVNLRSRNGWPGAVAHACNPSTLGGQGGRITRSGVRDQPDQHGLLWNLSSNDKLKNLMITEALLTLTENIIIPFSGWPEGDYPKANGLLDFDIFYNVTGCLRNMSSAGADGRKAMRRCDGLIDSLVHYVRGTIADYQPDDKATENCVCILHNLSYQLEAELPEKYSQNIYIQNRNIQTDNNKSIGCFGSRSRKVKEQYQDVPMPEEKSNPKGVEWLWHSIVIRMYLSLIAKSVRNYTQEASLGALQNLTAGSGPMPTSVAQTVVQKESGLQHTRKMLHVGDPSVKKTAISLLRNLSRNLSLQNEIAKETLPDLVSIIPDTVPSTDLLIETTASACYTLNNIIQNSYQNARDLLNTGGIQKIMAISAGDAYASNKASKAASVLLYSLWAHTELHHAYKKAQFKKTDFVNSRTAKAYHSLKD DIP protein Q99959 original sequence version: null 947838B0C8275D5D k2c5_human Keratin, type II cytoskeletal 5 Cytokeratin-5 58 kDa cytokeratin KRT5 Keratin-5 Type-II keratin Kb5 protein protein human Homo sapiens Human MSRQSSVSFRSGGSRSFSTASAITPSVSRTSFTSVSRSGGGGGGGFGRVSLAGACGVGGYGSRSLYNLGGSKRISISTSGGSFRNRFGAGAGGGYGFGGGAGSGFGFGGGAGGGFGLGGGAGFGGGFGGPGFPVCPPGGIQEVTVNQSLLTPLNLQIDPSIQRVRTEEREQIKTLNNKFASFIDKVRFLEQQNKVLDTKWTLLQEQGTKTVRQNLEPLFEQYINNLRRQLDSIVGERGRLDSELRNMQDLVEDFKNKYEDEINKRTTAENEFVMLKKDVDAAYMNKVELEAKVDALMDEINFMKMFFDAELSQMQTHVSDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIANRSRTEAESWYQTKYEELQQTAGRHGDDLRNTKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIADAEQRGELALKDARNKLAELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEGEECRLSGEGVGPVNISVVTSSVSSGYGSGSGYGGGLGGGLGGGLGGGLAGGSSGSYYSSSSGGVGLGGGLSVGGSGFSASSGRGLGVGFGSGGGSSSSVKFVSTTSSSRKSFKS DIP protein P13647 original sequence version: 149 E9D5318E01F55145 desm_mouse Desmin Des protein protein mouse Mus musculus Mouse MSQAYSSSQRVSSYRRTFGGAPGFSLGSPLSSPVFPRAGFGTKGSSSSMTSRVYQVSRTSGGAGGLGSLRSSRLGTTRAPSYGAGELLDFSLADAVNQEFLATRTNEKVELQELNDRFANYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEEMRELRRQVEVLTNQRARVDVERDNLIDDLQRLKAKLQEEIQLREEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEANGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTFSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL 58A8A13C7CC11EEF k1c15_human Keratin, type I cytoskeletal 15 KRT15 KRTB Cytokeratin-15 Keratin-15 protein protein human Homo sapiens Human MTTTFLQTSSSTFGGGSTRGGSLLAGGGGFGGGSLSGGGGSRSISASSARFVSSGSGGGYGGGMRVCGFGGGAGSVFGGGFGGGVGGGFGGGFGGGDGGLLSGNEKITMQNLNDRLASYLDKVRALEEANADLEVKIHDWYQKQTPTSPECDYSQYFKTIEELRDKIMATTIDNSRVILEIDNARLAADDFRLKYENELALRQGVEADINGLRRVLDELTLARTDLEMQIEGLNEELAYLKKNHEEEMKEFSSQLAGQVNVEMDAAPGVDLTRVLAEMREQYEAMAEKNRRDVEAWFFSKTEELNKEVASNTEMIQTSKTEITDLRRTMQELEIELQSQLSMKAGLENSLAETECRYATQLQQIQGLIGGLEAQLSELRCEMEAQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMAGIAIREASSGGGGSSSNFHINVEESVDGQVVSSHKREI 812C1343905EBE41 q13835-2 Plakophilin-1 1a PKP1 Band 6 protein protein protein human Homo sapiens Human MNHSPLKTALAYECFQDQDNSTLALPSDQKMKTGTSGRQRVQEQVMMTVKRQKSKSSQSSTLSHSNRGSMYDGLADNYNYGTTSRSSYYSKFQAGNGSWGYPIYNGTLKREPDNRRFSSYSQMENWSRHYPRGSCNTTGAGSDICFMQKIKASRSEPDLYCDPRGTLRKGTLGSKGQKTTQNRYSFYSTCSGQKAIKKCPVRPPSCASKQDPVYIPPISCNKDLSFGHSRASSKICSEDIECSGLTIPKAVQYLSSQDEKYQAIGAYYIQHTCFQDESAKQQVYQLGGICKLVDLLRSPNQNVQQAAAGALRNLVFRSTTNKLETRRQNGIREAVSLLRRTGNAEIQKQLTGLLWNLSSTDELKEELIADALPVLADRVIIPFSGWCDGNSNMSREVVDPEVFFNATGCLRNLSSADAGRQTMRNYSGLIDSLMAYVQNCVAASRCDDKSVENCMCVLHNLSYRLDAEVPTRYRQLEYNARNAYTEKSSTGCFSNKSDKMMNNNYDCPLPEEETNPKGSGWLYHSDAIRTYLNLMGKSKKDATLEACAGALQNLTASKGLMSSGMSQLIGLKEKGLPQIARLLQSGNSDVVRSGASLLSNMSRHPLLHRVMGNQVFPEVTRLLTSHTGNTSNSEDILSSACYTVRNLMASQPQLAKQYFSSSMLNNIINLCRSSASPKAAEAARLLLSDMWSSKELQGVLRQQGFDRNMLGTLAGANSLRNFTSRF AE49B9396487AD31 k1c18_human Keratin, type I cytoskeletal 18 KRT18 CYK18 Keratin-18 PIG46 Cytokeratin-18 Cell proliferation-inducing gene 46 protein protein protein human Homo sapiens Human MSFTTRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSFRGGMGSGGLATGIAGGLAGMGGIQNEKETMQSLNDRLASYLDRVRSLETENRRLESKIREHLEKKGPQVRDWSHYFKIIEDLRAQIFANTVDNARIVLQIDNARLAADDFRVKYETELAMRQSVENDIHGLRKVIDDTNITRLQLETEIEALKEELLFMKKNHEEEVKGLQAQIASSGLTVEVDAPKSQDLAKIMADIRAQYDELARKNREELDKYWSQQIEESTTVVTTQSAEVGAAETTLTELRRTVQSLEIDLDSMRNLKASLENSLREVEARYALQMEQLNGILLHLESELAQTRAEGQRQAQEYEALLNIKVKLEAEIATYRRLLEDGEDFNLGDALDSSNSMQTIQKTTTRRIVDGKVVSETNDTKVLRH DIP protein P05783 original sequence version: 186 DIP protein P05783 original sequence version: 175 1E5604C6BCC7A17A k2c8_human Keratin, type II cytoskeletal 8 Keratin-8 KRT8 CYK8 Cytokeratin-8 Type-II keratin Kb8 protein protein human Homo sapiens Human MSIRVTQKSYKVSTSGPRAFSSRSYTSGPGSRISSSSFSRVGSSNFRGGLGGGYGGASGMGGITAVTVNQSLLSPLVLEVDPNIQAVRTQEKEQIKTLNNKFASFIDKVRFLEQQNKMLETKWSLLQQQKTARSNMDNMFESYINNLRRQLETLGQEKLKLEAELGNMQGLVEDFKNKYEDEINKRTEMENEFVLIKKDVDEAYMNKVELESRLEGLTDEINFLRQLYEEEIRELQSQISDTSVVLSMDNSRSLDMDSIIAEVKAQYEDIANRSRAEAESMYQIKYEELQSLAGKHGDDLRRTKTEISEMNRNISRLQAEIEGLKGQRASLEAAIADAEQRGELAIKDANAKLSELEAALQRAKQDMARQLREYQELMNVKLALDIEIATYRKLLEGEESRLESGMQNMSIHTKTTSGYAGGLSSAYGGLTSPGLSYSLGSSFGSGAGSSSFSRTSSSRAVVVKKIETRDGKLVSESSDVLPK DIP protein P05787 original sequence version: 186 DIP protein P05787 original sequence version: 146 B0BC730B65929D37 krt5-pkp1-3 2 PKP1a 13 unspecified role unspecified role prey prey n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain his-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) CK5 10 unspecified role unspecified role bait bait partially purified partially purified 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association Fig 2A krt15-pkp1 2 CK15 12 unspecified role unspecified role bait bait partially purified partially purified 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes PKP1a 13 unspecified role unspecified role prey prey partially purified partially purified his-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Fig 2A(c) pkp1-krt5 2 CK5 10 unspecified role unspecified role prey prey partially purified partially purified ecoli Escherichia coli (strain K12) PKP1a 13 unspecified role unspecified role bait bait partially purified partially purified 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association Fig 2B lane1 krt18-pkp1-2 2 CK18 14 unspecified role unspecified role bait bait partially purified partially purified rod domain sufficient to bind sufficient binding region sufficient to bind autoradiography autoradiography range range range range 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes PKP1a 13 unspecified role unspecified role prey prey partially purified partially purified n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain his-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association Fig 2A data not shown krt8-pkp1-2 2 PKP1a 13 unspecified role unspecified role prey prey partially purified partially purified n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain his-tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role bait bait partially purified partially purified 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 autoradiography autoradiography undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rod sufficient to bind sufficient binding region sufficient to bind range range range range rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association Fig 2A data not shown pkp1-krt14 2 8 unspecified role unspecified role prey prey partially purified partially purified ecoli Escherichia coli (strain K12) PKP1a 13 unspecified role unspecified role bait bait partially purified partially purified 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association Fig 2B lane2 pkp1-krt8-2 2 15 unspecified role unspecified role prey prey partially purified partially purified ecoli Escherichia coli (strain K12) PKP1a 13 unspecified role unspecified role bait bait partially purified partially purified 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association Fig 2B lane3 pkp1-krt18-3 2 14 unspecified role unspecified role prey prey partially purified partially purified ecoli Escherichia coli (strain K12) PKP1a 13 unspecified role unspecified role bait bait partially purified partially purified 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association Fig 2B lane 4 pkp1-vim-2 2 7 unspecified role unspecified role prey prey partially purified partially purified ecoli Escherichia coli (strain K12) PKP1a 13 unspecified role unspecified role bait bait partially purified partially purified 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association Fig 2B lane 5 pkp2-krt5 2 CK5 10 unspecified role unspecified role prey prey partially purified partially purified ecoli Escherichia coli (strain K12) 9 autoradiography autoradiography autoradiography autoradiography unspecified role unspecified role bait bait partially purified partially purified 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes physical association physical association Fig 2B lane1 panel 3 pkp2-krt14 2 PKP2a 9 autoradiography autoradiography autoradiography autoradiography unspecified role unspecified role bait bait partially purified partially purified 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 8 unspecified role unspecified role prey prey partially purified partially purified ecoli Escherichia coli (strain K12) physical association physical association Fig 2B lane2 panel 3 pkp2-krt8 2 9 autoradiography autoradiography autoradiography autoradiography unspecified role unspecified role bait bait partially purified partially purified 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain non-arm-repeat domain rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 15 unspecified role unspecified role prey prey partially purified partially purified ecoli Escherichia coli (strain K12) physical association physical association Fig 2B lane3 panel3 and data not shown pkp2-krt18 2 9 autoradiography autoradiography autoradiography autoradiography unspecified role unspecified role bait bait partially purified partially purified n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes non-arm-repeat domain 14 unspecified role unspecified role prey prey partially purified partially purified ecoli Escherichia coli (strain K12) physical association physical association Fig 2B lane 4 panel 3 and data not shown pkp2-vim 2 9 autoradiography autoradiography autoradiography autoradiography unspecified role unspecified role bait bait partially purified partially purified 35s 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined non-arm-repeat domain n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 7 unspecified role unspecified role prey prey partially purified partially purified ecoli Escherichia coli (strain K12) physical association physical association Fig 2B lane 5 panel 3 and data not shown krt18-krt8-1 4 PKP1a 13 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component partially purified partially purified n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 15 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component partially purified partially purified rod sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) 14 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component partially purified partially purified rod domain required to bind necessary binding region required to bind range range range range ecoli Escherichia coli (strain K12) physical association physical association Fig 5 and 6 stoichiometry based on Fig 6 and results section: In our sedimentation experiments the molar ratio of PKP1a to IF proteins was varied from 1:130 to 8:1. However, the amount of pelleted PKP1a increased only up to a molar ratio of approximately 1:1. When present in excess over IFs, surplus PKP1a remained in the supernatant fraction. However this also assumes that the CKs are in 1:1 ratio based on statements that they are a heterodimer. I have assumed that heterodimer is 1 based on vimentin assay. Also in methods for affinity determinations it states: Samples of vimentin or desmin rod domains and equimolar mixtures of CK8 rod and CK18 rod were dialyzed into buffer On their own, CK8 as well as CK18, like PKP1a, remained in the supernatant fraction. Therefore both CK8 and CK18 are required for this association with PKP1a to be detected using this method krt14-krt5-1 4 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component partially purified partially purified ecoli Escherichia coli (strain K12) CK5 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component partially purified partially purified ecoli Escherichia coli (strain K12) PKP1a 13 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component partially purified partially purified ecoli Escherichia coli (strain K12) physical association physical association Fig 6 vim-pkp1-2 4 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component partially purified partially purified ecoli Escherichia coli (strain K12) PKP1a 13 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component partially purified partially purified ecoli Escherichia coli (strain K12) physical association physical association Fig 6 pkp1-vim-1 1 PKP1a 13 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait partially purified partially purified ecoli Escherichia coli (strain K12) 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey partially purified partially purified rod domain sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) physical association physical association Fig 7 pkp1-krt18-2 1 14 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey partially purified partially purified rod domain required to bind necessary binding region required to bind range range range range ecoli Escherichia coli (strain K12) 15 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey partially purified partially purified rod sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) PKP1a 13 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait partially purified partially purified ecoli Escherichia coli (strain K12) association association Fig 7 pkp1-des 1 11 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey partially purified partially purified rod domain sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) PKP1a 13 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait partially purified partially purified ecoli Escherichia coli (strain K12) physical association physical association Fig 7 pkp1-dsp 3 PKP1a 13 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Fig 8 pkp1-dsp-1 5 6 unspecified role unspecified role prey prey PKP1a 13 unspecified role unspecified role bait bait physical association physical association Fig 8b krt18-krt8-2 4 15 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component partially purified partially purified rod sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) 14 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component partially purified partially purified rod domain required to bind necessary binding region required to bind range range range range ecoli Escherichia coli (strain K12) physical association physical association Fig 5 lane 10,11