UniProt UniProt http://www.uniprot.org A20 inhibits NF-kappaB activation independently of binding to 14-3-3 proteins. A20 inhibits NF-kappaB activation independently of binding to 14-3-3 proteins. Biochem. Biophys. Res. Commun. (0006-291X) 1997 imex curation De Valck D., Heyninck K., Van Criekinge W., Vandenabeele P., Fiers W., Beyaert R. rudi@lmb1.rug.ac.be 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence De Valck D., Heyninck K., Van Criekinge W., Vandenabeele P., Fiers W., Beyaert R. rudi@lmb1.rug.ac.be Accepted 2012-MAY-23 by MGT L929r2 fibrosarcoma cDNA (murine) Biochem. Biophys. Res. Commun. (0006-291X) 1997 Only protein-protein interactions imex curation A20 inhibits NF-kappaB activation independently of binding to 14-3-3 proteins. A20 inhibits NF-kappaB activation independently of binding to 14-3-3 proteins. Biochem. Biophys. Res. Commun. (0006-291X) 1997 imex curation De Valck D., Heyninck K., Van Criekinge W., Vandenabeele P., Fiers W., Beyaert R. rudi@lmb1.rug.ac.be 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined De Valck D., Heyninck K., Van Criekinge W., Vandenabeele P., Fiers W., Beyaert R. rudi@lmb1.rug.ac.be Accepted 2012-MAY-23 by MGT 20-Jun-2012: Contacted by JYOTI. Biochem. Biophys. Res. Commun. (0006-291X) 1997 Only protein-protein interactions imex curation A20 inhibits NF-kappaB activation independently of binding to 14-3-3 proteins. A20 inhibits NF-kappaB activation independently of binding to 14-3-3 proteins. Biochem. Biophys. Res. Commun. (0006-291X) 1997 imex curation De Valck D., Heyninck K., Van Criekinge W., Vandenabeele P., Fiers W., Beyaert R. rudi@lmb1.rug.ac.be 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot De Valck D., Heyninck K., Van Criekinge W., Vandenabeele P., Fiers W., Beyaert R. rudi@lmb1.rug.ac.be Accepted 2012-MAY-23 by MGT 20-Jun-2012: Contacted by JYOTI. Biochem. Biophys. Res. Commun. (0006-291X) 1997 Only protein-protein interactions imex curation tnap3_human Tumor necrosis factor alpha-induced protein 3 Putative DNA-binding protein A20 Zinc finger protein A20 TNFAIP3 OTUD7C OTU domain-containing protein 7C protein protein human Homo sapiens Human MAEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQFREIIHKALIDRNIQATLESQKKLNWCREVRKLVALKTNGDGNCLMHATSQYMWGVQDTDLVLRKALFSTLKETDTRNFKFRWQLESLKSQEFVETGLCYDTRNWNDEWDNLIKMASTDTPMARSGLQYNSLEEIHIFVLCNILRRPIIVISDKMLRSLESGSNFAPLKVGGIYLPLHWPAQECYRYPIVLGYDSHHFVPLVTLKDSGPEIRAVPLVNRDRGRFEDLKVHFLTDPENEMKEKLLKEYLMVIEIPVQGWDHGTTHLINAAKLDEANLPKEINLVDDYFELVQHEYKKWQENSEQGRREGHAQNPMEPSVPQLSLMDVKCETPNCPFFMSVNTQPLCHECSERRQKNQNKLPKLNSKPGPEGLPGMALGASRGEAYEPLAWNPEESTGGPHSAPPTAPSPFLFSETTAMKCRSPGCPFTLNVQHNGFCERCHNARQLHASHAPDHTRHLDPGKCQACLQDVTRTFNGICSTCFKRTTAEASSSLSTSLPPSCHQRSKSDPSRLVRSPSPHSCHRAGNDAPAGCLSQAARTPGDRTGTSKCRKAGCVYFGTPENKGFCTLCFIEYRENKHFAAASGKVSPTASRFQNTIPCLGRECGTLGSTMFEGYCQKCFIEAQNQRFHEAKRTEEQLRSSQRRDVPRTTQSTSRPKCARASCKNILACRSEELCMECQHPNQRMGPGAHRGEPAPEDPPKQRCRAPACDHFGNAKCNGYCNECFQFKQMYG DIP protein P21580 original sequence version: 129 DIP protein P21580 original sequence version: 166 320AEA97F58D4491 1433z_mouse 14-3-3 protein zeta/delta Ywhaz Protein kinase C inhibitor protein 1 SEZ-2 protein protein mouse Mus musculus Mouse MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQPESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN DIP protein P63101 original sequence version: 72 2164DF3793B45B7A 1433f_mouse 14-3-3 protein eta Ywhah protein protein mouse Mus musculus Mouse MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLALLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEHMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN C12F62B4ABA76DA3 tnfaip3-ywhaz-1 1 5 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait physical association physical association no figure tnfaip3-ywhah 1 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association no figure tnfaip3-ywhah-1 2 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait P21580:p.Arg562Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain R A Wed May 02 17:06:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg562ala' Tue Jun 30 19:19:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg562Ala' P21580:p.Ser565Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S A Wed May 02 14:48:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser565ala' Tue Jun 30 19:31:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser565Ala' c-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table I and II tnfaip3-ywhaz-2 2 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait P21580:p.Arg562Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain R A Wed May 02 18:26:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg562ala' Tue Jun 30 16:52:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg562Ala' P21580:p.Ser565Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:16:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser565ala' Tue Jun 30 19:05:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser565Ala' c-terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association no figure tnfaip3-ywhah-2 3 4 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection P21580:p.Arg562Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain R A Wed May 02 20:04:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg562ala' Tue Jun 30 18:05:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg562Ala' P21580:p.Ser565Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S A Wed May 02 17:13:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser565ala' Tue Jun 30 17:45:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser565Ala' e-tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association 1