mbinfo MBInfo http://www.mechanobio.info/ p140mDia, a mammalian homolog of Drosophila diaphanous, is a target protein for Rho small GTPase and is a ligand for profilin. p140mDia, a mammalian homolog of Drosophila diaphanous, is a target protein for Rho small GTPase and is a ligand for profilin. EMBO J. (0261-4189) 1997 imex curation Watanabe N., Madaule P., Reid T., Ishizaki T., Watanabe G., Kakizuka A., Saito Y., Nakao K., Jockusch B.M., Narumiya S. The source of p140mDia inferred from the cDNA library used and the source of RhoA inferred from the references. contact-email not given in the paper. Mouse embryonic cDNA library. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Watanabe N., Madaule P., Reid T., Ishizaki T., Watanabe G., Kakizuka A., Saito Y., Nakao K., Jockusch B.M., Narumiya S. Y2H mating assays were done with two S.cerevisiae strains: AMR70 and L40. The source of p140mDia inferred from the cDNA library used and the source of RhoA inferred from the references. contact-email not given in the paper. Accepted 2012-MAY-30 by ORCHARD Mouse embryonic cDNA library. EMBO J. (0261-4189) 1997 Only protein-protein interactions imex curation p140mDia, a mammalian homolog of Drosophila diaphanous, is a target protein for Rho small GTPase and is a ligand for profilin. p140mDia, a mammalian homolog of Drosophila diaphanous, is a target protein for Rho small GTPase and is a ligand for profilin. EMBO J. (0261-4189) 1997 imex curation Watanabe N., Madaule P., Reid T., Ishizaki T., Watanabe G., Kakizuka A., Saito Y., Nakao K., Jockusch B.M., Narumiya S. The source of p140mDia inferred from the cDNA library used and the source of RhoA inferred from the references. contact-email not given in the paper. Mouse embryonic cDNA library. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Watanabe N., Madaule P., Reid T., Ishizaki T., Watanabe G., Kakizuka A., Saito Y., Nakao K., Jockusch B.M., Narumiya S. Interaction detection method: GST pull down. The source of p140mDia inferred from the cDNA library used and the source of RhoA inferred from the references. contact-email not given in the paper. Accepted 2012-MAY-30 by ORCHARD Mouse embryonic cDNA library. EMBO J. (0261-4189) 1997 Only protein-protein interactions imex curation p140mDia, a mammalian homolog of Drosophila diaphanous, is a target protein for Rho small GTPase and is a ligand for profilin. p140mDia, a mammalian homolog of Drosophila diaphanous, is a target protein for Rho small GTPase and is a ligand for profilin. EMBO J. (0261-4189) 1997 imex curation Watanabe N., Madaule P., Reid T., Ishizaki T., Watanabe G., Kakizuka A., Saito Y., Nakao K., Jockusch B.M., Narumiya S. The source of p140mDia inferred from the cDNA library used and the source of RhoA inferred from the references. contact-email not given in the paper. Mouse embryonic cDNA library. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Watanabe N., Madaule P., Reid T., Ishizaki T., Watanabe G., Kakizuka A., Saito Y., Nakao K., Jockusch B.M., Narumiya S. The source of p140mDia inferred from the cDNA library used and the source of RhoA inferred from the references. contact-email not given in the paper. Accepted 2012-MAY-30 by ORCHARD Mouse embryonic cDNA library. EMBO J. (0261-4189) 1997 Only protein-protein interactions imex curation diap1_mouse Protein diaphanous homolog 1 Diaphanous-related formin-1 p140mDIA Diaph1 Diap1 protein protein mouse Mus musculus Mouse MEPSGGGLGPGRGTRDKKKGRSPDELPATGGDGGKHKKFLERFTSMRIKKEKEKPNSAHRNSSASYGDDPTAQSLQDISDEQVLVLFEQMLVDMNLNEEKQQPLREKDIVIKREMVSQYLHTSKAGMNQKESSRSAMMYIQELRSGLRDMHLLSCLESLRVSLNNNPVSWVQTFGAEGLASLLDILKRLHDEKEETSGNYDSRNQHEIIRCLKAFMNNKFGIKTMLETEEGILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLDGLKSGTSIALKVGCLQLINALITPAEELDFRVHIRSELMRLGLHQVLQELREIENEDMKVQLCVFDEQGDEDFFDLKGRLDDIRMEMDDFGEVFQIILNTVKDSKAEPHFLSILQHLLLVRNDYEARPQYYKLIEECVSQIVLHKNGTDPDFKCRHLQIDIERLVDQMIDKTKVEKSEAKATELEKKLDSELTARHELQVEMKKMENDFEQKLQDLQGEKDALDSEKQQITAQKQDLEAEVSKLTGEVAKLSKELEDAKNEMASLSAVVVAPSVSSSAAVPPAPPLPGDSGTVIPPPPPPPPLPGGVVPPSPPLPPGTCIPPPPPLPGGACIPPPPQLPGSAAIPPPPPLPGVASIPPPPPLPGATAIPPPPPLPGATAIPPPPPLPGGTGIPPPPPPLPGSVGVPPPPPLPGGPGLPPPPPPFPGAPGIPPPPPGMGVPPPPPFGFGVPAAPVLPFGLTPKKVYKPEVQLRRPNWSKFVAEDLSQDCFWTKVKEDRFENNELFAKLTLAFSAQTKTSKAKKDQEGGEEKKSVQKKKVKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKEEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSENFSSLLELTLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSADQKMTLLHFLAELCENDHPEVLKFPDELAHVEKASRVSAENLQKSLDQMKKQIADVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAFRRKRGPRQVNRKAGCAVTSLLASELTKDDAMAPGPVKVPKKSEGVPTILEEAKELVGRAS DIP protein O08808 original sequence version: 62 DIP protein O08808 original sequence version: 141 09404164873CA7C1 prof1_human Profilin-1 Profilin I PFN1 Epididymis tissue protein Li 184a protein protein human Homo sapiens Human MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY DIP protein P07737 original sequence version: 73 DIP protein P07737 original sequence version: 160 DIP protein P07737 original sequence version: 97 DIP protein P07737 original sequence version: 98 DIP protein P07737 original sequence version: 168 DIP protein P07737 original sequence version: 140 F725119E55A289EB rhoa_human Transforming protein RhoA Rho cDNA clone 12 ARHA RHO12 RHOA ARH12 protein protein human Homo sapiens Human MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL DIP protein P61586 original sequence version: 86 DIP protein P61586 original sequence version: 123 DIP protein P61586 original sequence version: 57 DIP protein P61586 original sequence version: 88 DIP protein P61586 original sequence version: 87 DIP protein P61586 original sequence version: 85 DIP protein P61586 original sequence version: 125 DIP protein P61586 original sequence version: 132 C4DA2DC31FF858BC rhoa-diaph1 3 6 unspecified role unspecified role bait bait P61586:p.Thr19Asn mutation mutation mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T N Wed May 02 17:07:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr19asn' Tue Jun 30 16:06:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr19Asn' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Asn19 was not added as a feature since the effect of this mutation on the interaction was not shown for the Y2H screening experiment. 4 unspecified role unspecified role prey prey physical association physical association Fig 1. diaph1-rhoa-1 1 6 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain P61586:p.Thr19Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain T N Wed May 02 17:29:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr19asn' Tue Jun 30 20:12:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr19Asn' P61586:p.Gly14Val mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G V Wed May 02 14:55:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly14val' Tue Jun 30 20:09:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly14Val' Asn19-RhoA decreases interaction with p140mdia. But Asn19-RhoA-deltaC shows a strong interaction with p140mdia. 4 unspecified role unspecified role prey prey n-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 18 14 physical association physical association Fig 1. rhoa-diaph1-1 2 4 unspecified role unspecified role prey prey mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig 2B. p140mdia binds only to the GTP-bound form of RhoA and not to the GDP-bound form. Interaction detection method: GST pull down. pfn1-diaph1 2 5 unspecified role unspecified role bait bait human-platelet Homo sapiens platelet, thrombocytes platelet Platelet, thrombocyte 4 unspecified role unspecified role prey prey mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells physical association physical association Fig 4B. Interaction detection method: Agarose pull down.