MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Direct interactions between bidensovirus BmDNV-Z proteins and midgut proteins from the virus target Bombyx mori. Direct interactions between bidensovirus BmDNV-Z proteins and midgut proteins from the virus target Bombyx mori. FEBS J. (1742-464X) 2013 Bao YY., Chen LB., Wu WJ., Zhao D., Wang Y., Qin X., Zhang CX. suggested by lperfetto ecoli Escherichia coli (strain K12) bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Bao YY., Chen LB., Wu WJ., Zhao D., Wang Y., Qin X., Zhang CX. suggested by lperfetto FEBS J. (1742-464X) 2013 Direct interactions between bidensovirus BmDNV-Z proteins and midgut proteins from the virus target Bombyx mori. Direct interactions between bidensovirus BmDNV-Z proteins and midgut proteins from the virus target Bombyx mori. FEBS J. (1742-464X) 2013 Bao YY., Chen LB., Wu WJ., Zhao D., Wang Y., Qin X., Zhang CX. suggested by lperfetto yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Bao YY., Chen LB., Wu WJ., Zhao D., Wang Y., Qin X., Zhang CX. suggested by lperfetto FEBS J. (1742-464X) 2013 Direct interactions between bidensovirus BmDNV-Z proteins and midgut proteins from the virus target Bombyx mori. Direct interactions between bidensovirus BmDNV-Z proteins and midgut proteins from the virus target Bombyx mori. FEBS J. (1742-464X) 2013 Bao YY., Chen LB., Wu WJ., Zhao D., Wang Y., Qin X., Zhang CX. suggested by lperfetto yeast Saccharomyces cerevisiae Baker's yeast two hybrid pooling two hybrid pooling approach two hybrid pooling experimental particp experimental participant identification experimental particp Bao YY., Chen LB., Wu WJ., Zhao D., Wang Y., Qin X., Zhang CX. suggested by lperfetto FEBS J. (1742-464X) 2013 c7emf0_bommo Alpha-amylase Amy protein protein bommo Bombyx mori Silk moth MFRYILLLSAVTLALAYKNPHYASGRTTMVHLFEWKWDDIAAECERFLGPRGFGGIQVSPPNENLVIWSRNRPWWERYQPISYRLVTRSGNENQFSNMVRRCNNVGVRIYVDAIINHMTGTWNENVGTGGSTANFENWHYPAVPYGRNDFNWPHCVITGSDYNCCPDRVRNCELSGLKDLNQGSDYVRQQILNYMNRLIDMGVAGFRIDAAKHMWPHDLRVIYDRLRNLNTAHGFPSGARPYIYQEVIDLGGEAISRNEYTPLAAVTEFRFGLELSQAFQRRNQLRWLVNWGPQWGLLASGDALTFIDNHDNQRGHGAGGNILTYKQSRQYKGAIAFMLAHPYGYPQLMSSFAFTDTEAGPPMNSRGDITSPTINADNSCGNGWICEHRWRQIHNMVVFRNTAGNGALTNWWDNGSNQIAFCRGNQAFIAFNNDAWDMDQTLQTCLPAGTYCDIISGARSGNRCTGKSIVVGSDGRALIIHRSNEYDMMVAIHRGADSRL mint E887589C11D010F2 q4u3c2_bmdnd protein protein bmdnv-3 Bombyx mori densovirus 3 (isolate Silkworm/China/Zhenjiang/-) MNLKRLYVFCAVITAINSLSQSDLIQIRELIETNIIRLSKTFNGDISTINNFYRILVSVFELFNDLLVELDTPAVSNQLQLFEDEDTVPNDCLGIVGQMLIEYTDIPNDGSLTYLNIGTISSLTVTLDNQLYLILTVIYNNGRETIQEVHNTGSPTIVVDFYEIKHNNTFQEIKTSIYYVNFINFVLEYTVHEIEDIIVTRNINRYNQWSTQQRSRSRIAFIQQEAIDPDIRNEQLQESAILAKLHDAADTLEYYGISFLREYYIAYFQYTIYAETQKLDPEFYDDPLEKNVIYINRIVQALWRQ mint 4D7B6CE534A8121D o01953_bommo SP1 692357 protein protein bommo Bombyx mori Silk moth MKVFAAVLMALAAVVVAEEPIELDYHIKIGIPRAESLRRAEEAADFDGTRIVGGSAANAGAHPHLAGLVIALTNGRTSICGASLLTNTRSVTAAHCWRTRRAQARQFTLALGTANIFSGGTRVTTSNVQMHGSYNMDTLHNDVAIINHNHVGFTNNIQRINLASGSNNFAGTWAWAAGFGRTSDAASGANNQQKRQVSLQVITNAVCARTFGNNVIIASTLCVDGSNGRSTCSGDSGGPLTIGSGGSRQLIGITSFGSAQGCQRGHPAGFARVTSFNSWIRARI mint 30D34E3EEEDEA72A q5uan9_bommo 692715 RpS5 protein protein bommo Bombyx mori Silk moth MAEENWNDDVAEAGSVVVETMSLPQAADIPEIKLFGRWSCYDVQVSDMSLQDYISVKEKYAKYLPHSAGRYAHKRFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGPREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECVADELINAAKGSSNSYAIKKKDELERVAKSNR mint BCDA2A92D8B32D83 q4u3c5_bmdnd protein protein bmdnv-3 Bombyx mori densovirus 3 (isolate Silkworm/China/Zhenjiang/-) MESKSNFRILSNEIISKPSSLISNISSPSTSLIPRSLQKSAKRLTISSLESGNGKQQMKSKLAQVQRALRFCRDYNIVKYYQFMDIPPEEYRELRTHCSKDVLETAADINYQEYYYEEVNNRLQVFLSYGDGSWGEEEEEIVMLFKHNNVDISKFCEALYSIFTMSDYRKNCIFLNGNIKTGKTLMMRLITGNFKCVGKGCNNGVNSEFYYQKFIGRSICVLEEPFLDPQTLEDFKSIFGGEGFDISCKFHNPQTLNRTPFIITSNFSLLSRGHAPSISEMAIKDRFYIFNFNNSYTPKCKLSPKNFVNVYNKYYG mint E7EC17FF30870BBC q4u3c0_bmdnd protein protein bmdnv-3 Bombyx mori densovirus 3 (isolate Silkworm/China/Zhenjiang/-) MLRLTDLHKPSCEPKGLSFYAYKAFIPYREKLSKEWNKLPVCIKDQEVDIKQEVKEDQLIRKIYKWDSVFDSWNWSKGYKLPKPLYELLEIYMKLWKLDNRTTYPDWGESSMIFKCYRYIRNKRMEDIENLSTEEFNDSNFNGWPKTMWYICRNCFDNGIVINNNSNDYYYTCDFSDNPTLLHYTDYFYYILNNDYWCYDCKYTPLFTLTTLFCLESINDSE mint E1584A25D7F7A4FE h9bvm4_bommo protein protein bommo Bombyx mori Silk moth MLFKTLIFFCFAGASLAYRSYENYKVYNVVPTSEIHIQMLGDLKKAGYDFWTDILTIGGNARVMVAPEQEQEFANYALSVGLKPNVTISNVQALINSQLQPATNARSSTLGSFSWDRYYSLAQIHSWLDELVTLYPGVVTTMVIGTSFEGRELKGIVIDFKKGERGNNPLIGMIEGGIHSREWISPATVTWIIKEFLTSDDPDVRFLAETFIWHIVPVTNPDGYTYTFSEDRMWRKNRNPVNYVPCATGNLDLGNGIDLNRNFNFLWMTTGASSNPCTQTYAGPSPSSELEAQAISNYVLRLKETGNFLYYFAFHSYSQMILVPYSHVSGQNVLEASNYADMYEIAIRGAEKLTARHGTQYQVGTSADILYEVSGSSFDWVKGVADIPIVYLFELRDVGEFGFLLPSEQIIPNNEEIMDCLVEMDKTTRQLSYYSGTVPMYASFISLATSILFLILMK mint A3C0C103EED6F047 o92427_npvbm lef-9 protein protein bmnpv Bombyx mori nuclear polyhedrosis virus MFSFLDKTPTEFDLILDLHKLQNVAFFTNEEFKVILKNFITDLKKNQKLNYFNSLIDQLINVYTDTSAKNTQPDVLAKIIKSTCVIVTDLPSNVFLKKLKTNKFTDTINYLILPHFILWDHNFVIFLNKAFNSKHENNLVDISGALQKIKLTHGVIKDQLQRKNGYAVQYLYSTFLNTASFYANVQCLNGVNEIMPPRSSVKRYYGRDVDNVRAWTTRHPNISQLSTQVSDVHINESSTDWNVKVGLGIFPGANTDCDGDKKIITFLPKPNSLIDSECLLYGDPRFNFICFDKNRLSFVSQQIYYLYKNIDAMEALFKSTPLVYALWQKHKHEQFAQRLEMLLRDFCLIASSNASYLLFKQLTQLIANEEMVCGDEEIFNLGGQFVDMIESGAKGSQNLIKSTQQYRQTLNTDIETVSLRATTSLNSYISSHNKVKVCGADIYHNTVVLQSVFIKNNYVCYKNDERTIMNICALPSEFLFPEHLLDMFIE mint homomint BCCB06AE49B0C044 h9bvm5_bommo protein protein bommo Bombyx mori Silk moth MNIKYGILFVALFAAAWALPKPEDDMSIFYEHVDRNARIVGGSQAAQGSHPHMVAMTNGIFIRSFVCGGSVLTARSVLTAAHCIVAVFTLGSLSGNLRLTVGTNQWNSGGSLHTVSRNITHPHYVSNTIKNDLGILITSSNIVFNNRVRPISLSFDYVPGGVPVRVAGWGRVRANGALSTNLLEINVRTIDGQTCVRTAAQAAIDLNVRAPPVEPHIELCTLHAEGTGTCNGDSGSALARTDSGLQVGIVSWGFPCARGAPDMFVRVSAFRSWLQQNIS mint 3E95E5C7F0F21ECA q9bmq7_bommo protein protein bommo Bombyx mori Silk moth MAGKMAVAYLIGILYTVSLVQGNPVNAGSEAIIEDLRNTDRQSRIVAGWPAEDAQIPHQISLRMVSPVGGVSSCGGSIIHHEWVLTAAHCLANRINFVVRLGLTNLTRPDYLVETTHKFIHPRYIEILGGVQTDDIALVKLNHHIPYSRYIQPCRLQNSEQKNINYEGAIFTVSGYGRTDDPWNGGVASEILLWVHLRGITNEQCLTHYPNSRVIQEQTLCAAYYNDTAQSSCQGDSGGPLTIVDEDGQPTMVGVVSFGHRDGCNSPHPSAYVRPGHYHEWFYEVTGINFDWSSEDLKPIVLAEAQDDVIAAE mint B05512AC02EDCDA7 q1hpt9_bommo protein protein bommo Bombyx mori Silk moth MVSVLTLAVAVLAAVCSCTASDLGRPVSIGEHPSLVQIEVFLPILNQWFQQCAGIVLTNYHYLSTATCFHGEFYDPAYRRIIAGSSRRSEPGEISYVHFAVNHPEFSEENYDKDVSIVRVTHAIHFGPNIQQGAIIQQGVVIPQGIFVDLLGWGTTVQGGSVSDGNLHKLELIVTNKENCREQYKGHDRVVTDNKFCAGLVRAGGRDYDNTDLGAPAFFQNALVGIVSFGKSNANDIYPVVLTSISSFTEWILQNVH mint 3DFC432812848E6B q9xy10_bommo protein protein bommo Bombyx mori Silk moth MAYRTVVIFLVAFVGGQALADDTDFTFPEIARDRSLPGSRIVSGWEASEGQFPYQLSIRMVSTVGGVNACGATIIHSNWGLTAAHCTGLRVTIIVRAGAVNLTRPGLLFETTKYINHPEYSENLNVVQPHDIGLIDFGRKIEFNDYIQPIRLQRSADKNRNYDNVRLVASGWGRTWTGGSSPENLNWVFLNGISNLRCMVAYNFSPTIQPSTICTLGYNDTTQSTCQGDSGGPLTVIDEDGQITQVGVTSFVSSEGCHVDIPSGFIRPGHYLDWFKTVTGLDFDWTPSTPEAPETTEAPGTTEAPDTSTETDTSNLLF mint 0E3C91091097BA4E ef2_bommo Translation elongation factor 2 tef2 protein protein bommo Bombyx mori Silk moth MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRCITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPILFMNKMDRALLELQLEAEELYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYADKFKIDLVKLMNRLWGENFFNPQTKKWSKQKDDDNKRSFCMYVLDPIYKVFDAIMKFKKEEIDDLLKKIGVTIKHEDSDKDGKALLKVVMRSWLPAGEALLQMIAIHLPSPVVAQKYRMEMLYEGPHDDEAAIGIKSCDPEAPLMMYVSKMVPTSDKGRFYAFGRVFSGKVVTGQKARIMGPNFTPGKKEDLYEKTIQRTILMMGRYVEAIEDVPSGNICGLVGVDQFLVKTGTITTFKNAHNMKVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQCINEESGEHIVAGAGELHLEICLKDLEEDHACIPIKKSDPVVSYRETVAEESDQLCLSKSPNKHNRLFMKAQPMPDGLPEDIDEGRVNPRDDFKTRARYLTEKYEYDVTEARKIWCFGPEGTGPNILVDCSKGVQYLNEIKDSVVAGFQWAAKEGVMAEENLRGVRFNIYDVTLHTDAIHRGGGQIIPTTRRCLYACLLTAQPRLMEPVYLCEIQCPEVAVGGIYGVLNRRRGHVFEESQVAGTPMFIVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQVLPGDPCEPQSKPYNVVQETRKRKGLKEGLPDLTQYLDKL mint 8BA138DE257A33BC q1hq70_bommo Transgelin protein protein bommo Bombyx mori Silk moth MANNRATKSGFAAEAQRKINSKYSEELAHESLEWIRMITGEPENTSGDMDNFYEVLKDGTLLCKLANNIHPNMIKKINTSSMAFKCMENINAFLEAARQLGVPAQETFQTVDLWERQNLNSVVICLQSLGRKAGTYGKPSIGPKEAEKNVRNFSEEQLRAGQGVISLQYGSNKGANQSGINFGNTRHM mint 1E3528E464527299 c4b7z7_bommo protein protein bommo Bombyx mori Silk moth MFTIDFHDERITSFNKNQTRKIIICVITGGRTSCESARVGTTTLPISASEDVCMTLYSCGWETRFDLNTRKCIILMLCRALRPVSIRTIFRSVSLTTLTGVFQQAYALFNLLNAVWN mint 916E8C6BBCA60136 q4u3c6_bmdnd protein protein bmdnv-3 Bombyx mori densovirus 3 (isolate Silkworm/China/Zhenjiang/-) MAFNALNRPSKWSITLLNEDCEITPDDLRVLVATLTGLDIRAVPGEENPVIVKKNGIEVKFPYTIKRDNLKAKLADIEHLISLNVLNSSLTSEEREKADDLLSRIRKRKAADEVEAGSSAKSSKIL mint 053B9B34BC2D1AE4 q4u3c3_bmdnd DNA-directed DNA polymerase protein protein bmdnv-3 Bombyx mori densovirus 3 (isolate Silkworm/China/Zhenjiang/-) MIRKPFCNFKMPLVKITEDTPATPGYYYSTSKDELASFLEKVLDNTPIGQLSVSFHVAGSFLKDDERKIIHTTPDVFNIHSDGIIPIDVQIDNFIEDYLDPEKSSFSKYSGSGFSLQVILSYWVNIVPYSPNNIAVPTSRNTQDYRDGTPAPIELNLSSSIRRNFIGVIAQHFTEPGYTKSGKVKSTYPLEVIEEFIKQRGFERYAELAVNVSTIPAIHAELNEFNIIIWSITGIPIYAKILGEVDEVPIHMLKKGDNLHLIRSIRAFLNENKTNQNRVFCTLCKKFHIPNACNITGEIICIDDIKDNEKDKGLISPISKPKIIYPNTKHCLVAYADFEAIIDNNIHKPASYSLIPIIAGDPPAENFIFTKSVLNLEDEVFNEDGEIIKFDNIIEMFLTDLYSIIKKFQTNDYGKEANLIDEAGERFKCLACNKNKKGKYYYARHYGLGIFGYYCRSCFLAHNNTFIVYFHNFKGYDHHILLEQLLNKDSKHNTCRGKSINKMDVITHKDILSDFIRITFKDTFNFLPESLASLANKLTTLKYTPDKFKEAFNSGKGEFPYEWFDDFNKLEEIEVPQDPADWDSRLTNKKGTEEIIKKANQIWIDNNMQIFHDYVLLYNELDVWLLLEVFEAFRDTTVNEDKIDPVYFDGAPGLTFYLARMYENSLDMHVIPDKNVYLDVSRNIRGGVTQVVTKYANIEDVDETIVYLDVNTMYSYCMKQKLANKYLGTLDALPDNYDSDDNFCYFIKGDFSYPEYLHDLPAHLSMPLMPHQYNNKLCTTFLDKKDMLIHSKVFKYYLSKGLVCDKIHYVYKFKQEYIIKDYVETNIQKRNSSTDPGTKDYYKLKNNALFGKTCENVFKYKIFSVTNVNSGDRENKCMSKAKSHITLGNCILYEECVTRYLLDKPIQIGFTILELAKLMIYEFIYELFDVIPEGSTATMLYTDTDSVIFKFKGFNGVHPYKYLLTTSLASKLDIPINKDGSFGSATKTPGLWSDDTKYKTITEFIGLRAKQYAYSIANDRDILKHKGIPKNALKDDNNPMNVNDFRNVLFEMKDLTVNIAQIRATKNVLTSTVSKKLALSTKDNKRITYTDKVTTLPFGYKGELYSNYMDDVVIE mint A03BAA914F23443E o92407_npvbm p47 protein protein bmnpv Bombyx mori nuclear polyhedrosis virus MFVTRLEHTTQFLPQACKLEDEVLVLYAIYLNGFDYTLPRFVKREVQVNADGFLRFDYNIKIFDFARFTDMTQATPEDIDDYINLTRIDSLSDHDLKMLQLVCRDRWYKGDVARLRRILQQKDVDDLVKFACNVMWERAYENHYTLGQQLSIRITTKLIQSGLDFKHQPDTTAPVSVRGWEDATFEKYLQSITSISEVIKRHVFSKKYICLEVAASYWSDTVESLQQENFRIILNSKTPYVLLIEMDDDKNSMVYLRKLAHMLENKIVNLLFVTDVEFYFKNGNFMFYLYNSLKFYYYCLKNKFAFESADKEIFFLLYTIVALEWFNGGHLNSFTLEKSALYNPLELSTRRLNSIKRAAQHNRVINCDSEINMDYIRGKRVRTGAHYGKRVVNFDQSLY mint homomint 69114411E6599C63 q4u3c6-rps5 3 ribosomal protein S5 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined BmDNV VD1-ORF1 19 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association T1 mint q4u3c5-q9bmq7 3 BmDNV VD1-ORF2 8 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 35 kDa protease 13 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association T1 mint q4u3c5-c4b7z7 3 olfactory receptor 18 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined BmDNV VD1-ORF2 8 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association T1 mint q4u3c3-q9xy10 3 BmDNV VD1-ORF4 20 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 30 kP protease A 15 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association T1 mint q4u3c3-amy 3 alpha amylase 4 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined BmDNV VD1-ORF4 20 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association T1 mint q4u3c3-h9bvm5 3 BmDNV VD1-ORF4 20 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chymotrypsin-like protein 12 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association T1 mint q4u3c3-h9bvm4 3 BmDNV VD1-ORF4 20 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined carboxypeptidase 10 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association T1 mint q4u3c3-tef2 3 translation elongation factor 2 16 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined BmDNV VD1-ORF4 20 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association T1 mint q4u3c3-c4b7z7 3 olfactory receptor 18 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined BmDNV VD1-ORF4 20 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association T1 mint q4u3c3-q1hpt9 3 BmDNV VD1-ORF4 20 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined trypsin-like protease 14 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association T1 mint q4u3c3-q9bmq7 3 BmDNV VD1-ORF4 20 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 35 kDa protease 13 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association T1 mint q4u3c2-q9bmq7 3 BmDNV VD2-ORF1 5 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 35 kDa protease 13 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association T1 mint q4u3c2-rps5 3 BmDNV VD2-ORF1 5 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ribosomal protein S5 7 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association T1 mint q4u3c0-loc692357 3 BmDNV VD2-ORF3 9 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined serine protease precursor 6 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association T1 mint q4u3c0-q1hq70 3 BmDNV VD2-ORF3 9 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined transgelin 17 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association T1 mint rps5-q4u3c6 2 ribosomal protein S5 7 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined BmDNV VD1-ORF1 19 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association T1 F1 mint q9bmq7-q4u3c5 2 BmDNV VD1-ORF2 8 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 35 kDa protease 13 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association T1 F1 mint c4b7z7-q4u3c5 2 olfactory receptor 18 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined BmDNV VD1-ORF2 8 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association T1 F1 mint q9xy10-q4u3c3 2 BmDNV VD1-ORF4 20 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 30 kP protease A 15 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association T1 F1 mint h9bvm4-q4u3c3 2 carboxypeptidase 10 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined BmDNV VD1-ORF4 20 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association T1 F1 mint tef2-q4u3c3 2 BmDNV VD1-ORF4 20 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined translation elongation factor 2 16 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association T1 F1 mint q1hpt9-q4u3c3 2 BmDNV VD1-ORF4 20 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined trypsin-like protease 14 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association T1 F1 mint loc692357-q4u3c0 2 BmDNV VD2-ORF3 9 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined serine protease precursor 6 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association T1 F1 mint q1hq70-q4u3c0 2 transgelin 17 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined BmDNV VD2-ORF3 9 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association T1 F1 mint q4u3c5-q9bmq7-1 1 35 kDa protease 13 tag fluorescence tag visualisation by fluorescence tag fluorescence experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined BmDNV VD1-ORF2 8 tag fluorescence tag visualisation by fluorescence tag fluorescence experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F4A mint q4u3c2-q9bmq7-1 1 BmDNV VD2-ORF1 5 tag fluorescence tag visualisation by fluorescence tag fluorescence experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 35 kDa protease 13 tag fluorescence tag visualisation by fluorescence tag fluorescence experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F4B mint loc692357-q4u3c0-1 1 serine protease precursor 6 tag fluorescence tag visualisation by fluorescence tag fluorescence experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined BmDNV VD2-ORF3 9 tag fluorescence tag visualisation by fluorescence tag fluorescence experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F4C mint q1hq70-q4u3c0-1 1 BmDNV VD2-ORF3 9 tag fluorescence tag visualisation by fluorescence tag fluorescence experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined transgelin 17 tag fluorescence tag visualisation by fluorescence tag fluorescence experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association F4D mint lef_9-p47 1 BmNPV P47 21 tag fluorescence tag visualisation by fluorescence tag fluorescence experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined BmNPV LEF-9 11 tag fluorescence tag visualisation by fluorescence tag fluorescence experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint F4E As the positive control, the interaction between BmNPV P47 and LEF9 proteins was captured in the cytoplasm of BmN cells (Fig. 4E).