IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ RNF168 Ubiquitinates K13-15 on H2A/H2AX to Drive DNA Damage Signaling. RNF168 Ubiquitinates K13-15 on H2A/H2AX to Drive DNA Damage Signaling. Cell (0092-8674) 2012 imex curation Mattiroli F., Vissers J.H., van Dijk W.J., Ikpa P., Citterio E., Vermeulen W., Marteijn J.A., Sixma T.K. Interactions involving H2A or in vitro ubiquitinations could not be captured as is proved impossible to trace all the components and map to a single gene product. t.sixma@nki.nl 15-Nov-2012: Contacted by pporras. Only protein-protein interactions in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined Mattiroli F., Vissers J.H., van Dijk W.J., Ikpa P., Citterio E., Vermeulen W., Marteijn J.A., Sixma T.K. Interactions involving H2A or in vitro ubiquitinations could not be captured as is proved impossible to trace all the components and map to a single gene product. t.sixma@nki.nl Accepted 2012-NOV-07 by MGT 15-Nov-2012: Contacted by pporras. Cell (0092-8674) 2012 Only protein-protein interactions imex curation RNF168 Ubiquitinates K13-15 on H2A/H2AX to Drive DNA Damage Signaling. RNF168 Ubiquitinates K13-15 on H2A/H2AX to Drive DNA Damage Signaling. Cell (0092-8674) 2012 imex curation Mattiroli F., Vissers J.H., van Dijk W.J., Ikpa P., Citterio E., Vermeulen W., Marteijn J.A., Sixma T.K. Interactions involving H2A or in vitro ubiquitinations could not be captured as is proved impossible to trace all the components and map to a single gene product. t.sixma@nki.nl 15-Nov-2012: Contacted by pporras. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Mattiroli F., Vissers J.H., van Dijk W.J., Ikpa P., Citterio E., Vermeulen W., Marteijn J.A., Sixma T.K. Interactions involving H2A or in vitro ubiquitinations could not be captured as is proved impossible to trace all the components and map to a single gene product. t.sixma@nki.nl Accepted 2012-NOV-07 by MGT 15-Nov-2012: Contacted by pporras. Cell (0092-8674) 2012 Only protein-protein interactions imex curation zinc(2+) zinc(2+) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) rnf8_human E3 ubiquitin-protein ligase RNF8 RNF8 KIAA0646 RING finger protein 8 RING-type E3 ubiquitin transferase RNF8 protein protein human Homo sapiens Human MGEPGFFVTGDRAGGRSWCLRRVGMSAGWLLLEDGCEVTVGRGFGVTYQLVSKICPLMISRNHCVLKQNPEGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEYEYEVTEEDWETIYPCLSPKNDQMIEKNKELRTKRKFSLDELAGPGAEGPSNLKSKINKVSCESGQPVKSQGKGEVASTPSDNLDPKLTALEPSKTTGAPIYPGFPKVTEVHHEQKASNSSASQRSLQMFKVTMSRILRLKIQMQEKHEAVMNVKKQTQKGNSKKVVQMEQELQDLQSQLCAEQAQQQARVEQLEKTFQEEEQHLQGLEIAQGEKDLKQQLAQALQEHWALMEELNRSKKDFEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNCINKMVNNLSSEVKERRIVLIRERKAKRLF 54650B2FFC9948B1 rnf8-zinc_2__ 2 3 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp. Table 1 1.9A Rworking = 0.2 Rfree = 0.23 rnf8-zinc_2__-1 1 4 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig. 2C Supp Fig. 2A