IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ EGF Receptor Is Required for KRAS-Induced Pancreatic Tumorigenesis. EGF Receptor Is Required for KRAS-Induced Pancreatic Tumorigenesis. Cancer Cell (1535-6108) 2012 imex curation Ardito C.M., Gruner B.M., Takeuchi K.K., Lubeseder-Martellato C., Teichmann N., Mazur P.K., Delgiorno K.E., Carpenter E.S., Halbrook C.J., Hall J.C., Pal D., Briel T., Herner A., Trajkovic-Arsic M., Sipos B., Liou G.Y., Storz P., Murray N.R., Threadgill D.W., Sibilia M., Washington M.K., Wilson C.L., Schmid R.M., Raines E.W., Crawford H.C., Siveke J.T. Cancer - Interactions investigated in the context of cancer Interactions including GST-Raf1-RBD could not be included due to lack of antibody specificity. Sorry - I would have omitted this publication (results here are only in the Supplement) but I had already started annotating the GST-pull down + assigned Imex ID, before I found out I could not finish it... Pancreata of 3 month old KrasG12D mice. crawford.howard@mayo.edu, jens.siveke@lrz.tu-muenchen.de 15-Nov-2012: Contacted by pporras. Only protein-protein interactions mouse-pancreatic ductal adenocarcinoma cells mouse-pancreatic ductal adenocarcinoma cells pancreatic_adenocarcinoma Pancreatic ductal adenocarcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ardito C.M., Gruner B.M., Takeuchi K.K., Lubeseder-Martellato C., Teichmann N., Mazur P.K., Delgiorno K.E., Carpenter E.S., Halbrook C.J., Hall J.C., Pal D., Briel T., Herner A., Trajkovic-Arsic M., Sipos B., Liou G.Y., Storz P., Murray N.R., Threadgill D.W., Sibilia M., Washington M.K., Wilson C.L., Schmid R.M., Raines E.W., Crawford H.C., Siveke J.T. Cancer - Interactions investigated in the context of cancer Interactions including GST-Raf1-RBD could not be included due to lack of antibody specificity. Sorry - I would have omitted this publication (results here are only in the Supplement) but I had already started annotating the GST-pull down + assigned Imex ID, before I found out I could not finish it... Pancreata of 3 month old KrasG12D mice. crawford.howard@mayo.edu, jens.siveke@lrz.tu-muenchen.de Accepted 2012-OCT-11 by PPORRAS 15-Nov-2012: Contacted by pporras. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation EGF Receptor Is Required for KRAS-Induced Pancreatic Tumorigenesis. EGF Receptor Is Required for KRAS-Induced Pancreatic Tumorigenesis. Cancer Cell (1535-6108) 2012 imex curation Ardito C.M., Gruner B.M., Takeuchi K.K., Lubeseder-Martellato C., Teichmann N., Mazur P.K., Delgiorno K.E., Carpenter E.S., Halbrook C.J., Hall J.C., Pal D., Briel T., Herner A., Trajkovic-Arsic M., Sipos B., Liou G.Y., Storz P., Murray N.R., Threadgill D.W., Sibilia M., Washington M.K., Wilson C.L., Schmid R.M., Raines E.W., Crawford H.C., Siveke J.T. Cancer - Interactions investigated in the context of cancer Interactions including GST-Raf1-RBD could not be included due to lack of antibody specificity. Sorry - I would have omitted this publication (results here are only in the Supplement) but I had already started annotating the GST-pull down + assigned Imex ID, before I found out I could not finish it... Pancreata of 3 month old KrasG12D mice. crawford.howard@mayo.edu, jens.siveke@lrz.tu-muenchen.de 15-Nov-2012: Contacted by pporras. Only protein-protein interactions mouse-pancreas Mus musculus pancreas pancreas confocal microscopy confocal microscopy immunostaining immunostaining Ardito C.M., Gruner B.M., Takeuchi K.K., Lubeseder-Martellato C., Teichmann N., Mazur P.K., Delgiorno K.E., Carpenter E.S., Halbrook C.J., Hall J.C., Pal D., Briel T., Herner A., Trajkovic-Arsic M., Sipos B., Liou G.Y., Storz P., Murray N.R., Threadgill D.W., Sibilia M., Washington M.K., Wilson C.L., Schmid R.M., Raines E.W., Crawford H.C., Siveke J.T. Cancer - Interactions investigated in the context of cancer Interactions including GST-Raf1-RBD could not be included due to lack of antibody specificity. Sorry - I would have omitted this publication (results here are only in the Supplement) but I had already started annotating the GST-pull down + assigned Imex ID, before I found out I could not finish it... Pancreata of 3 month old KrasG12D mice. crawford.howard@mayo.edu, jens.siveke@lrz.tu-muenchen.de Accepted 2012-OCT-11 by PPORRAS 15-Nov-2012: Contacted by pporras. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation rask_mouse GTPase KRas K-Ras 2 Ki-Ras c-K-ras c-Ki-ras Kras Kras2 protein protein mouse Mus musculus Mouse MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQELARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGCVKIKKCVIM DIP protein P32883 original sequence version: 102 97345422E01D2C81 egfr_mouse Epidermal growth factor receptor Egfr protein protein mouse Mus musculus Mouse MRPSGTARTTLLVLLTALCAAGGALEEKKVCQGTSNRLTQLGTFEDHFLSLQRMYNNCEVVLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNALYENTYALAILSNYGTNRTGLRELPMRNLQEILIGAVRFSNNPILCNMDTIQWRDIVQNVFMSNMSMDLQSHPSSCPKCDPSCPNGSCWGGGEENCQKLTKIICAQQCSHRCRGRSPSDCCHNQCAAGCTGPRESDCLVCQKFQDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYVVTDHGSCVRACGPDYYEVEEDGIRKCKKCDGPCRKVCNGIGIGEFKDTLSINATNIKHFKYCTAISGDLHILPVAFKGDSFTRTPPLDPRELEILKTVKEITGFLLIQAWPDNWTDLHAFENLEIIRGRTKQHGQFSLAVVGLNITSLGLRSLKEISDGDVIISGNRNLCYANTINWKKLFGTPNQKTKIMNNRAEKDCKAVNHVCNPLCSSEGCWGPEPRDCVSCQNVSRGRECVEKCNILEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGIMGENNTLVWKYADANNVCHLCHANCTYGCAGPGLQGCEVWPSGPKIPSIATGIVGGLLFIVVVALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQAHLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPYGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASDISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELILEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMEDVVDADEYLIPQQGFFNSPSTSRTPLLSSLSATSNNSTVACINRNGSCRVKEDAFLQRYSSDPTGAVTEDNIDDAFLPVPEYVNQSVPKRPAGSVQNPVYHNQPLHPAPGRDLHYQNPHSNAVGNPEYLNTAQPTCLSSGFNSPALWIQKGSHQMSLDNPDYQQDFFPKETKPNGIFKGPTAENAEYLRVAPPSSEFIGA DIP protein Q01279 original sequence version: 168 DIP protein Q01279 original sequence version: 161 DIP protein Q01279 original sequence version: 162 DIP protein Q01279 original sequence version: 126 690E20D46DF2D2F5 egfr-kras 1 3 unspecified role unspecified role prey prey P32883:p.Gly12Asp mutation mutation certain certain sequence position certain certain certain sequence position certain G D Wed May 02 20:23:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly12asp' Tue Jun 30 20:09:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly12Asp' 4 unspecified role unspecified role bait bait physical association physical association S5B kras-egfr 1 3 unspecified role unspecified role bait bait P32883:p.Gly12Asp mutation mutation certain certain sequence position certain certain certain sequence position certain G D Wed May 02 19:41:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly12asp' Tue Jun 30 15:36:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly12Asp' 4 unspecified role unspecified role prey prey physical association physical association S5B egfr-kras-2 2 4 unspecified role unspecified role neutral component neutral component 3 unspecified role unspecified role neutral component neutral component P32883:p.Gly12Asp mutation mutation certain certain sequence position certain certain certain sequence position certain G D Wed May 02 19:15:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly12asp' Tue Jun 30 19:51:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly12Asp' colocalization colocalization S5C