IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structure of Escherichia coli BamB and its interaction with POTRA domains of BamA. Structure of Escherichia coli BamB and its interaction with POTRA domains of BamA. Acta Crystallogr. D Biol. Crystallogr. (0907-4449) 2012 imex curation Dong C., Yang X., Hou H.F., Shen Y.Q., Dong Y.H. dongyh@ihep.ac.cn 15-Nov-2012: Contacted by pporras. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Dong C., Yang X., Hou H.F., Shen Y.Q., Dong Y.H. dongyh@ihep.ac.cn Accepted 2012-OCT-29 by ORCHARD 15-Nov-2012: Contacted by pporras. Acta Crystallogr. D Biol. Crystallogr. (0907-4449) 2012 Only protein-protein interactions imex curation bama_ecoli Outer membrane protein assembly factor BamA bamA Omp85 yaeT yzzN yzzY JW0172 b0177 protein protein ecoli Escherichia coli (strain K12) MAMKKLLIASLLFSSATVYGAEGFVVKDIHFEGLQRVAVGAALLSMPVRTGDTVNDEDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEGVSAEIQQINIVGNHAFTTDELISHFQLRDEVPWWNVVGDRKYQKQKLAGDLETLRSYYLDRGYARFNIDSTQVSLTPDKKGIYVTVNITEGDQYKLSGVEVSGNLAGHSAEIEQLTKIEPGELYNGTKVTKMEDDIKKLLGRYGYAYPRVQSMPEINDADKTVKLRVNVDAGNRFYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVYKVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTVDGVSLGGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAVYFPHQASNYDPDYDYECATQDGAKDLCKSDDAVGGNAMAVASLEFITPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSPLGPLVFSYAQPFKKYDGDKAEQFQFNIGKTW DIP protein P0A940 original sequence version: 84 DIP protein P0A940 original sequence version: 102 DIP protein P0A940 original sequence version: 103 DDCE4C6D341664EB bamb_ecoli Outer membrane protein assembly factor BamB bamB yfgL JW2496 b2512 protein protein ecoli Escherichia coli (strain K12) MQLRKLLLPGLLSVTLLSGCSLFNSEEDVVKMSPLPTVENQFTPTTAWSTSVGSGIGNFYSNLHPALADNVVYAADRAGLVKALNADDGKEIWSVSLAEKDGWFSKEPALLSGGVTVSGGHVYIGSEKAQVYALNTSDGTVAWQTKVAGEALSRPVVSDGLVLIHTSNGQLQALNEADGAVKWTVNLDMPSLSLRGESAPTTAFGAAVVGGDNGRVSAVLMEQGQMIWQQRISQATGSTEIDRLSDVDTTPVVVNGVVFALAYNGNLTALDLRSGQIMWKRELGSVNDFIVDGNRIYLVDQNDRVMALTIDGGVTLWTQSDLLHRLLTSPVLYNGNLVVGDSEGYLHWINVEDGRFVAQQKVDSSGFQTEPVAADGKLLIQAKDGTVYSITR DIP protein P77774 original sequence version: 112 DIP protein P77774 original sequence version: 127 DIP protein P77774 original sequence version: 128 BCFAFA061A486B31 bamb-bama 1 2 unspecified role unspecified role prey prey nucl transformation nucleic acid transformation nucl transformation region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain his-ha tag tandem tag tandem tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 3 unspecified role unspecified role bait bait nucl transformation nucleic acid transformation nucl transformation region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 7 9 direct interaction direct interaction Figure 4