mpidb The Microbial Protein Interaction Database Functional Divergence of FimX in PilZ Binding and Type IV Pilus Regulation. Functional Divergence of FimX in PilZ Binding and Type IV Pilus Regulation. J. Bacteriol. (0021-9193) 2012 imex curation Qi Y., Xu L., Dong X., Yau Y.H., Ho C.L., Koh S.L., Shochat S.G., Chou S.H., Tang K., Liang Z.X. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Qi Y., Xu L., Dong X., Yau Y.H., Ho C.L., Koh S.L., Shochat S.G., Chou S.H., Tang K., Liang Z.X. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation Functional Divergence of FimX in PilZ Binding and Type IV Pilus Regulation. Functional Divergence of FimX in PilZ Binding and Type IV Pilus Regulation. J. Bacteriol. (0021-9193) 2012 imex curation Qi Y., Xu L., Dong X., Yau Y.H., Ho C.L., Koh S.L., Shochat S.G., Chou S.H., Tang K., Liang Z.X. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Qi Y., Xu L., Dong X., Yau Y.H., Ho C.L., Koh S.L., Shochat S.G., Chou S.H., Tang K., Liang Z.X. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation Functional Divergence of FimX in PilZ Binding and Type IV Pilus Regulation. Functional Divergence of FimX in PilZ Binding and Type IV Pilus Regulation. J. Bacteriol. (0021-9193) 2012 imex curation Qi Y., Xu L., Dong X., Yau Y.H., Ho C.L., Koh S.L., Shochat S.G., Chou S.H., Tang K., Liang Z.X. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro h1-h2 ms mass spectrometry study of hydrogen/deuterium exchange h1-h2 ms predetermined predetermined participant predetermined Qi Y., Xu L., Dong X., Yau Y.H., Ho C.L., Koh S.L., Shochat S.G., Chou S.H., Tang K., Liang Z.X. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation Functional Divergence of FimX in PilZ Binding and Type IV Pilus Regulation. Functional Divergence of FimX in PilZ Binding and Type IV Pilus Regulation. J. Bacteriol. (0021-9193) 2012 imex curation Qi Y., Xu L., Dong X., Yau Y.H., Ho C.L., Koh S.L., Shochat S.G., Chou S.H., Tang K., Liang Z.X. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Qi Y., Xu L., Dong X., Yau Y.H., Ho C.L., Koh S.L., Shochat S.G., Chou S.H., Tang K., Liang Z.X. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation q8pnd9_xanac pilZ XAC1133 protein protein xanac Xanthomonas axonopodis pv. citri (strain 306) MSAMNARQGILSLALKDKPALYSAYMPFVKGGGIFVPTPKRYMLGDEVFLLLTLPDSSERLPVAGKVIWTTPAGAQGNRAAGIGVQFPDGPEGEAVRNKIETLLAGLTTSDKPTHTM F7D088359A13555E q8pjx9_xanac XAC2398 protein protein xanac Xanthomonas axonopodis pv. citri (strain 306) MQKGKDLTLRLMIVDDSVESAETIVTALRNGGIAVRPSRPQSQEELASMLSGQIDLAILGQAQQIPMSALQTQIAGSGKDIPILLLAERIEENALVEAASHGVRAIALRHRPAHLLALVRSEWDDLQARRGLRRIEAQMRETERRCDALIASSRDPIAYVHEGMHIRANDAYLEMFGFESFDDVEGISLLDMIAAQYVDDFKQLLKAMSKGEPPPAQYKLDARRVEGDTFPATMEFATATYEGEPCIQVVFRRREEFDPELAREVEDLRQRDQVTGLLNRPTFMVALEQAVAQAGRSEGQSGFLLIEPDHYARILPEFGLDSADALIAALAAHVASVLDDSVLAARFGEHSFALLLNGNYARTHALAETVRNAFAQHVFSVGTRSATVTVSIGGVQIGEKIASIGQVLNRGTEAVRTTAELGGNAVSIYDPAAADRAEEERIERWVEQLREALVGDGFLLHYQPVLNLQGEPLELYQAFLRLERNGEMMSPNAFMAIAEEHDLVTEIDRWVVARAIRQLGERQRAGHKTHLLVRIGPNSFSDPQMIDTIREQLAVYGVPGERLWLQTPESKVFTHLRNAQQFLAAVSAMDCKVGLEQFGSGLDSFQLLAHFHPAFLKLDRGITGDIASARDSQEKIREITSRAQPAGILTMAEFVADAQSMSSFFSAGVDYVQGDFVAPTGPLMNYEFG 9477086E930FCC4A g3xcz3_pseae pilZ PA2960 protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MSLPPNLGPRNGILSLTIKDKSVLYAAYMPFIRNGGLFIPTNKNYKLGDEVFMLLNLMEEPEKIPVAGKVVWITPKGAQGNRAAGIGVQFNDGDNTARNKIETYLAGALKSDRPTHTM 55F357D2C752308D pilz-q8pjx9 4 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey region Q8PJX9-436-689 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 1 pilz-q8pjx9-6 2 5 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region Q8PJX9-436-689 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association Figure 2 pilz-q8pjx9-9 1 6 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region Q8PJX9-436-689 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 3c pilz-q8pjx9-7 1 5 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component Q8PJX9:p.Ala493Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain A E Wed May 02 20:09:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala493glu' Tue Jun 30 16:33:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala493Glu' Q8PJX9:p.[Leu459Arg;Met488Glu;Ala493Glu] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain M E certain certain sequence position certain certain certain sequence position certain A E certain certain sequence position certain certain certain sequence position certain L R Wed May 02 16:31:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu459arg,met488glu,ala493glu' Tue Jun 30 16:20:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu459Arg;Met488Glu;Ala493Glu]' region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region Q8PJX9-436-689 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q8PJX9:p.Met488Glu mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain M E Wed May 02 15:29:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met488glu' Tue Jun 30 19:07:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met488Glu' Q8PJX9:p.[Leu459Arg;Met488Glu] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain L R certain certain sequence position certain certain certain sequence position certain M E Wed May 02 16:49:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu459arg,met488glu' Tue Jun 30 17:09:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu459Arg;Met488Glu]' ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 3 pilz-q8pjx9-8 3 5 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region Q8PJX9-436-689 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Figure 4