IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Self-organized shuttling: generating sharp dorsoventral polarity in the early Drosophila embryo. Self-organized shuttling: generating sharp dorsoventral polarity in the early Drosophila embryo. Cell (0092-8674) 2012 imex curation Haskel-Ittah M., Ben-Zvi D., Branski-Arieli M., Schejter E.D., Shilo B.Z., Barkai N. HeLa cells expressing membrane-anchored V5-N-Spz-TM were incubated with SP-C-Spz-GFP, or with a signal peptide-GFP (SP-GFP) fusion protein, that served as a control. Subsequent immunohistochemical staining was performed on nonpermeabilized cells, so that only extracellular proteins were detected. benny.shilo@weizmann.ac.il, naama.barkai@weizmann.ac.il 15-Nov-2012: Contacted by pporras. Only protein-protein interactions in vitro In vitro affinity techniques affinity technology affinity techniques immunostaining immunostaining Haskel-Ittah M., Ben-Zvi D., Branski-Arieli M., Schejter E.D., Shilo B.Z., Barkai N. HeLa cells expressing membrane-anchored V5-N-Spz-TM were incubated with SP-C-Spz-GFP, or with a signal peptide-GFP (SP-GFP) fusion protein, that served as a control. Subsequent immunohistochemical staining was performed on nonpermeabilized cells, so that only extracellular proteins were detected. HeLa cells expressing membrane-anchored V5-N-Spz-TM were incubated with SP-C-Spz-GFP, or with a signal peptide-GFP (SP-GFP) fusion protein, that served as a control. Subsequent immunohistochemical staining was performed on nonpermeabilized cells, so that only extracellular proteins were detected. benny.shilo@weizmann.ac.il, naama.barkai@weizmann.ac.il Accepted 2012-NOV-06 by MGT 15-Nov-2012: Contacted by pporras. Cell (0092-8674) 2012 Only protein-protein interactions imex curation p48607-pro_0000022407 Protein spaetzle C-106 spz CG6134 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly VGGSDERFLCRSIRKLVYPKKGLRADDTWQLIVNNDEYKQAIQIEECEGADQPCDFAANFPQSYNPICKQHYTQQTLASIKSDGELDVVQNSFKIPSCCKCALKTG 221 326 BC7212FDEB0A1E37 spz_drome Protein spaetzle spz CG6134 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MMTPMWISLFKVLLLLFAFFATYEAKEYERIIKELFTITNDEGVVLFNTSADSAPFMPIPTQHDDPTQKQKQNQNQSPIPETNRHYHQYHSLIQPDQYFKVQRSPNGKLNLVFNDTFVSLQRTDTEVQSEQPIPPRHPSDTFVFPDSPIAKYRPPQSPARPLRNDTKEHNPCAKDESQHLRNFCTNVDDYPDLSGLTHKLKNNFAKFFSNDLQPTDVSSRVGGSDERFLCRSIRKLVYPKKGLRADDTWQLIVNNDEYKQAIQIEECEGADQPCDFAANFPQSYNPICKQHYTQQTLASIKSDGELDVVQNSFKIPSCCKCALKTG 3252389129CFB1E0 spz-spz-1 1 3 unspecified role unspecified role neutral component neutral component region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal egfr transmembrane domain fusion protein fusion protein c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 2 unspecified role unspecified role neutral component neutral component spz signal region fusion protein fusion protein certain certain sequence position certain certain certain sequence position certain region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. physical association physical association Fig. 5A-C