mpidb The Microbial Protein Interaction Database Role of EscP (Orf16) in Injectisome Biogenesis and Regulation of Type III Protein Secretion in Enteropathogenic Escherichia coli. Role of EscP (Orf16) in Injectisome Biogenesis and Regulation of Type III Protein Secretion in Enteropathogenic Escherichia coli. J. Bacteriol. (0021-9193) 2012 imex curation Monjaras Feria J., Garcia-Gomez E., Espinosa N., Minamino T., Namba K., Gonzalez-Pedrajo B. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli pull down pull down western blot western blot Immuno blot Immuno blot Monjaras Feria J., Garcia-Gomez E., Espinosa N., Minamino T., Namba K., Gonzalez-Pedrajo B. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation Role of EscP (Orf16) in Injectisome Biogenesis and Regulation of Type III Protein Secretion in Enteropathogenic Escherichia coli. Role of EscP (Orf16) in Injectisome Biogenesis and Regulation of Type III Protein Secretion in Enteropathogenic Escherichia coli. J. Bacteriol. (0021-9193) 2012 imex curation Monjaras Feria J., Garcia-Gomez E., Espinosa N., Minamino T., Namba K., Gonzalez-Pedrajo B. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Monjaras Feria J., Garcia-Gomez E., Espinosa N., Minamino T., Namba K., Gonzalez-Pedrajo B. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation q9aj18_ecolx st20 escI ABE90_014010 ACN68_25520 DIV22_19815 EAN77_23745 EAX79_25040 ERS085386_04455 ERS085411_02891 NCTC8009_02036 NCTC8179_06345 NCTC8622_07613 NCTC8960_02095 NCTC9111_01238 NCTC9703_05350 protein protein ecolx Escherichia coli MDALCHYLSHEKRLTVNMNNINQSENINIHFNKVSQTNFVDDHTPLAPTPSAAGAAQFLDQLLPKTAGVSSPEQVLIEEIKKRHLATMNTDLSFDALSAGGLSPEDVLTLQKNVLNANVNVDVVSKLASLLSTSVTKLVSMQ FE164289C3090D69 o52142_ecolx D3G36_10545 protein protein ecolx Escherichia coli MTRVSLKRNLIEPVSFRPSDDWPQGEESFNDIFYHIKKRSPDTLFIRMASLWKRLFYSSGRRRRYFEEGEHSFSILCGRLRGVVLTIKCSNGIIYLSIKISQNNRNHVFLYHKKDYVFDKLKEIFPDEAIEFTIEYEN 8E01CBC1D0254102 cest_eco27 Tir chaperone cesT E2348C_3940 protein protein eco27 Escherichia coli O127:H6 (strain E2348/69 / EPEC) MSSRSELLLDRFAEKIGVGSISFNENRLCSFAIDEIYYISLSDANDEYMMIYGVCGKFPTDNPNFALEILNANLWFAENGGPYLCYESGAQSLLLALRFPLDDATPEKLENEIEVVVKSMENLYLVLHNQGITLENEHMKIEEISSSDNKHYYAGR 1E9F7ED2B9D5F1DF b7umb8_eco27 escU E2348C_3960 protein protein eco27 Escherichia coli O127:H6 (strain E2348/69 / EPEC) MSEKTEKPTPKKLRDLKKKGDVTKSEEVMAAVQSLILFSFFSLYGMSFFVDIVGLVNTTIDSLNRPFLYAIREILGAVLNIFLLYILPISLIVFVGTVTTGVSQIGFIFAVEKIKPSAQKISVKNNLKNIFSVKSIFELLKSVFKLVIIVLIFYFMGHSYANEFANFTGLNAYQALVVVAFFVFLLWKGVLFGYLLFSVFDFWFQKHEGLKKMKMSKDEVKREAKDTDGNPEIKGERRRLHSEIQSGSLANNIKKSTVIVKNPTHIAICLYYKLGETPLPLVIETGKDAKALQIIKLAELYDIPVIEDIPLARSLYKNIHKGQYITEDFFEPVAQLIRIAIDLDY F2F3941BDA27D845 b7um90_eco27 escF E2348C_3932 protein protein eco27 Escherichia coli O127:H6 (strain E2348/69 / EPEC) MNLSEITQQMGEVGKTLSDSVPELLNSTDLVNDPEKMLELQFAVQQYSAYVNVESGMLKTIKDLVSTISNRSF ABE7169FDBDCE1B7 o52142-cest 1 5 unspecified role unspecified role prey prey p21244-- P21244-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait o52142-- O52142-- mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association figure 8 o52142-esci 1 3 unspecified role unspecified role prey prey q9aj18-- Q9AJ18-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait o52142-- O52142-- mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association figure 7 o52142-escf 1 7 unspecified role unspecified role neutral component neutral component b7um90-- B7UM90-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait o52142-- O52142-- mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association figure 7 o52142-escu 1 6 unspecified role unspecified role prey prey n-terminal B7UMB8-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region B7UMB8-- sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait o52142-- O52142-- mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association figure 6 o52142-cest-1 2 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association figure 8 o52142-esci-1 2 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association figure 7 o52142-escf-1 2 4 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association figure 7 o52142-escu-1 2 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait physical association physical association figure 6