IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ A Bistable Circuit Involving SCARECROW-RETINOBLASTOMA Integrates Cues to Inform Asymmetric Stem Cell Division. A Bistable Circuit Involving SCARECROW-RETINOBLASTOMA Integrates Cues to Inform Asymmetric Stem Cell Division. Cell (0092-8674) 2012 imex curation Cruz-Ramirez A., Diaz-Trivino S., Blilou I., Grieneisen V.A., Sozzani R., Zamioudis C., Miskolczi P., Nieuwland J., Benjamins R., Dhonukshe P., Caballero-Perez J., Horvath B., Long Y., Mahonen A.P., Zhang H., Xu J., Murray J.A., Benfey P.N., Bako L., Maree A.F., Scheres B. H2A/H2B interaction could not be added as the proteins could not be ascribed to a single gene product. b.scheres@uu.nl, stan.maree@jic.ac.uk 15-Nov-2012: Contacted by pporras. Only protein-protein interactions arath-seedling Arabidopsis thaliana seedling ch-ip chromatin immunoprecipitation assay ch-ip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Cruz-Ramirez A., Diaz-Trivino S., Blilou I., Grieneisen V.A., Sozzani R., Zamioudis C., Miskolczi P., Nieuwland J., Benjamins R., Dhonukshe P., Caballero-Perez J., Horvath B., Long Y., Mahonen A.P., Zhang H., Xu J., Murray J.A., Benfey P.N., Bako L., Maree A.F., Scheres B. H2A/H2B interaction could not be added as the proteins could not be ascribed to a single gene product. H2A/H2B interaction could not be added as the proteins could not be ascribed to a single gene product. b.scheres@uu.nl, stan.maree@jic.ac.uk Accepted 2012-NOV-01 by PPORRAS 15-Nov-2012: Contacted by pporras. Cell (0092-8674) 2012 Only protein-protein interactions imex curation A Bistable Circuit Involving SCARECROW-RETINOBLASTOMA Integrates Cues to Inform Asymmetric Stem Cell Division. A Bistable Circuit Involving SCARECROW-RETINOBLASTOMA Integrates Cues to Inform Asymmetric Stem Cell Division. Cell (0092-8674) 2012 imex curation Cruz-Ramirez A., Diaz-Trivino S., Blilou I., Grieneisen V.A., Sozzani R., Zamioudis C., Miskolczi P., Nieuwland J., Benjamins R., Dhonukshe P., Caballero-Perez J., Horvath B., Long Y., Mahonen A.P., Zhang H., Xu J., Murray J.A., Benfey P.N., Bako L., Maree A.F., Scheres B. H2A/H2B interaction could not be added as the proteins could not be ascribed to a single gene product. b.scheres@uu.nl, stan.maree@jic.ac.uk 15-Nov-2012: Contacted by pporras. Only protein-protein interactions arath-seedling Arabidopsis thaliana seedling anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Cruz-Ramirez A., Diaz-Trivino S., Blilou I., Grieneisen V.A., Sozzani R., Zamioudis C., Miskolczi P., Nieuwland J., Benjamins R., Dhonukshe P., Caballero-Perez J., Horvath B., Long Y., Mahonen A.P., Zhang H., Xu J., Murray J.A., Benfey P.N., Bako L., Maree A.F., Scheres B. H2A/H2B interaction could not be added as the proteins could not be ascribed to a single gene product. b.scheres@uu.nl, stan.maree@jic.ac.uk Accepted 2012-NOV-01 by PPORRAS 15-Nov-2012: Contacted by pporras. Cell (0092-8674) 2012 Only protein-protein interactions imex curation A Bistable Circuit Involving SCARECROW-RETINOBLASTOMA Integrates Cues to Inform Asymmetric Stem Cell Division. A Bistable Circuit Involving SCARECROW-RETINOBLASTOMA Integrates Cues to Inform Asymmetric Stem Cell Division. Cell (0092-8674) 2012 imex curation Cruz-Ramirez A., Diaz-Trivino S., Blilou I., Grieneisen V.A., Sozzani R., Zamioudis C., Miskolczi P., Nieuwland J., Benjamins R., Dhonukshe P., Caballero-Perez J., Horvath B., Long Y., Mahonen A.P., Zhang H., Xu J., Murray J.A., Benfey P.N., Bako L., Maree A.F., Scheres B. H2A/H2B interaction could not be added as the proteins could not be ascribed to a single gene product. b.scheres@uu.nl, stan.maree@jic.ac.uk 15-Nov-2012: Contacted by pporras. Only protein-protein interactions arath-mesophyll Arabidopsis thaliana mesophyll mesophyll Mesophyll of plant leaf The photosynthetic parenchyma between the epidermal layers of a foliage leaf. bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Cruz-Ramirez A., Diaz-Trivino S., Blilou I., Grieneisen V.A., Sozzani R., Zamioudis C., Miskolczi P., Nieuwland J., Benjamins R., Dhonukshe P., Caballero-Perez J., Horvath B., Long Y., Mahonen A.P., Zhang H., Xu J., Murray J.A., Benfey P.N., Bako L., Maree A.F., Scheres B. H2A/H2B interaction could not be added as the proteins could not be ascribed to a single gene product. b.scheres@uu.nl, stan.maree@jic.ac.uk Accepted 2012-NOV-01 by PPORRAS 15-Nov-2012: Contacted by pporras. Cell (0092-8674) 2012 Only protein-protein interactions imex curation A Bistable Circuit Involving SCARECROW-RETINOBLASTOMA Integrates Cues to Inform Asymmetric Stem Cell Division. A Bistable Circuit Involving SCARECROW-RETINOBLASTOMA Integrates Cues to Inform Asymmetric Stem Cell Division. Cell (0092-8674) 2012 imex curation Cruz-Ramirez A., Diaz-Trivino S., Blilou I., Grieneisen V.A., Sozzani R., Zamioudis C., Miskolczi P., Nieuwland J., Benjamins R., Dhonukshe P., Caballero-Perez J., Horvath B., Long Y., Mahonen A.P., Zhang H., Xu J., Murray J.A., Benfey P.N., Bako L., Maree A.F., Scheres B. H2A/H2B interaction could not be added as the proteins could not be ascribed to a single gene product. b.scheres@uu.nl, stan.maree@jic.ac.uk 15-Nov-2012: Contacted by pporras. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Cruz-Ramirez A., Diaz-Trivino S., Blilou I., Grieneisen V.A., Sozzani R., Zamioudis C., Miskolczi P., Nieuwland J., Benjamins R., Dhonukshe P., Caballero-Perez J., Horvath B., Long Y., Mahonen A.P., Zhang H., Xu J., Murray J.A., Benfey P.N., Bako L., Maree A.F., Scheres B. H2A/H2B interaction could not be added as the proteins could not be ascribed to a single gene product. b.scheres@uu.nl, stan.maree@jic.ac.uk Accepted 2012-NOV-01 by PPORRAS 15-Nov-2012: Contacted by pporras. Cell (0092-8674) 2012 Only protein-protein interactions imex curation A Bistable Circuit Involving SCARECROW-RETINOBLASTOMA Integrates Cues to Inform Asymmetric Stem Cell Division. A Bistable Circuit Involving SCARECROW-RETINOBLASTOMA Integrates Cues to Inform Asymmetric Stem Cell Division. Cell (0092-8674) 2012 imex curation Cruz-Ramirez A., Diaz-Trivino S., Blilou I., Grieneisen V.A., Sozzani R., Zamioudis C., Miskolczi P., Nieuwland J., Benjamins R., Dhonukshe P., Caballero-Perez J., Horvath B., Long Y., Mahonen A.P., Zhang H., Xu J., Murray J.A., Benfey P.N., Bako L., Maree A.F., Scheres B. H2A/H2B interaction could not be added as the proteins could not be ascribed to a single gene product. b.scheres@uu.nl, stan.maree@jic.ac.uk 15-Nov-2012: Contacted by pporras. Only protein-protein interactions arath-protoplast Arabidopsis thaliana protoplast Protoplast defined as a membrane-bound cell from which the outer wall has been partially or completely removed. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Cruz-Ramirez A., Diaz-Trivino S., Blilou I., Grieneisen V.A., Sozzani R., Zamioudis C., Miskolczi P., Nieuwland J., Benjamins R., Dhonukshe P., Caballero-Perez J., Horvath B., Long Y., Mahonen A.P., Zhang H., Xu J., Murray J.A., Benfey P.N., Bako L., Maree A.F., Scheres B. H2A/H2B interaction could not be added as the proteins could not be ascribed to a single gene product. b.scheres@uu.nl, stan.maree@jic.ac.uk Accepted 2012-NOV-01 by PPORRAS 15-Nov-2012: Contacted by pporras. Cell (0092-8674) 2012 Only protein-protein interactions imex curation A Bistable Circuit Involving SCARECROW-RETINOBLASTOMA Integrates Cues to Inform Asymmetric Stem Cell Division. A Bistable Circuit Involving SCARECROW-RETINOBLASTOMA Integrates Cues to Inform Asymmetric Stem Cell Division. Cell (0092-8674) 2012 imex curation Cruz-Ramirez A., Diaz-Trivino S., Blilou I., Grieneisen V.A., Sozzani R., Zamioudis C., Miskolczi P., Nieuwland J., Benjamins R., Dhonukshe P., Caballero-Perez J., Horvath B., Long Y., Mahonen A.P., Zhang H., Xu J., Murray J.A., Benfey P.N., Bako L., Maree A.F., Scheres B. H2A/H2B interaction could not be added as the proteins could not be ascribed to a single gene product. b.scheres@uu.nl, stan.maree@jic.ac.uk 15-Nov-2012: Contacted by pporras. Only protein-protein interactions arath-mesophyll Arabidopsis thaliana mesophyll mesophyll Mesophyll of plant leaf The photosynthetic parenchyma between the epidermal layers of a foliage leaf. split renilla luciferase complementation Split renilla luciferase complementation renilla luciferase renilla luciferase tag luciferase tag visualisation by luciferase assay tag luciferase Cruz-Ramirez A., Diaz-Trivino S., Blilou I., Grieneisen V.A., Sozzani R., Zamioudis C., Miskolczi P., Nieuwland J., Benjamins R., Dhonukshe P., Caballero-Perez J., Horvath B., Long Y., Mahonen A.P., Zhang H., Xu J., Murray J.A., Benfey P.N., Bako L., Maree A.F., Scheres B. H2A/H2B interaction could not be added as the proteins could not be ascribed to a single gene product. b.scheres@uu.nl, stan.maree@jic.ac.uk Accepted 2012-NOV-01 by PPORRAS 15-Nov-2012: Contacted by pporras. Cell (0092-8674) 2012 Only protein-protein interactions imex curation ccd61_arath Putative cyclin-D6-1 CYCD6-1 G1/S-specific cyclin-D6-1 F4C21.20 At4g03270 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEFHLEHPLSHSSLHNNFNDDTDYETLPHSLFLVEFQHMPSSHYFHSLKSSAFLLSNRNQAISSITQYSRKFDDPSLTYLAVNYLDRFLSSEDMPQSKPWILKLISLSCVSLSAKMRKPDMSVSDLPVEGEFFDAQMIERMENVILGALKWRMRSVTPFSFLAFFISLFELKEEDPLLLKHSLKSQTSDLTFSLQHDISFLEFKPSVIAGAALLFASFELCPLQFPCFSNRINQCTYVNKDELMECYKAIQERDIIVGENEGSTETAVNVLDQQFSSCESDKSITITASSSPKRRKTSTRRY FE3515EAEA209A17 nuc_arath_gene Zinc finger protein NUTCRACKER gene gene gene arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress e2fc_arath Transcription factor E2FC E2FC At1g47870 E2F2 E2F transcription factor-2 T2E6.2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAATSNSGEDPTLSYHHRSPFRFELLQSISSSDPRYSSLTPSSTNRPFSVSQSLPNSQLSPLISPHWDDSYSQITQKVQKSRKNHRIQLGSIANMSGGESIDIAKVIVKQESSPQNVKRVYNKSKGGTKLLKAGKRMANGEVQNGGLNGASINCRYDSSLGLLTKKFVKLIQEAEDGTLDLNYCAVVLEVQKRRIYDITNVLEGIGLIEKTTKNHIRWKGADNLGQKDLGDQISRLKSEVESMQSEESRLDDLIRERQEALRSLEEDDYCRRYMFMTEEDITSLPRFQNQTLLAIKAPTASYIEVPDPDEMSFPQQYRMVIRSRMGPIDVYLLSKYKGDSAETSDKLGNESDQKAPVGVDTPSLKIVTSDTDLKADYWFESDAEVSLTDLWSNFNS 8D071E79F81BF567 rbr1_arath Retinoblastoma-related protein 1 RBR1 At3g12280 RBR F28J15.11 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEVQPPVTPPIEPNGKRSEASLLDICEKVLSLDGSTCDEALKLFTETKRILSASMSNIGSGTREEVERFWFAFILYSVKRLSVRKEADGLSVSGDNEFNLCQILRALKLNIVDFFKELPQFVVKAGSVLGELYGADWENRLQAKEVQANFVHLSLLSKYYKRGFREFFLTYDANAEKNSANSSTYLLDSYRFGWLLFLALRNHAFSRFKDLVTCSNGVVSILAILIIHVPCRFRNFSIQDSSRFVKKGDKGVDLVASLCKIYDASEDELRIVIDKANNLVETILKKKPSPASECQTDKLDNIDPDGLTYFEDLLEETSISTSLITLEKDYYDGKGELDERVFINEEDSLLGSGSLSAGAVNITGVKRKIDALSSPARTFISPLSPHKSPAAKTNGISGATKLAATPVSTAMTTAKWLRTVISPLLPKPSPGLEHFLKSCDRDITNDVTRRAHIILEAIFPNSSLGAQCGGGSLQAVDLMDDIWAEQRRLEACKLYYRVLEAMCKAEAQILHANNLNSLLTNERFHRCMLACSAELVLATHKTITMLFPAVLERTGITAFDLSKVIESFIRHEDSLPRELRRHLNSLEERLLESMVWEKGSSMYNSLIVARPSLALEINQLGLLAEPMPSLDAIAALINFSDGANHASSVQKHETCPGQNGGIRSPKRLCTDYRSILVERNSFTSPVKDRLLALGNVKSKMLPPPLQSAFASPTRPNPGGGGETCAETGINIFFTKINKLAAVRINGMVERLQLSQQIRESVYCFFQHVLAQRTSLLFSRHIDQIILCCFYGVAKISQMSLTFREIIYNYRKQPQCKPLVFRSVYVDALQCRRQGRIGPDHVDIITFYNEIFIPAVKPLLVELGPVRNDRAVEANNKPEGQCPGSPKVSVFPSVPDMSPKKVSAVHNVYVSPLRGSKMDALISHSTKSYYACVGESTHAYQSPSKDLSAINNRLNNSSSNRKRTLNFDAEAGMVSDSMVANSLNLQNQNQNQNGSDASSSGGAAPLKTEPTDS DIP protein Q9LKZ3 original sequence version: 38 DIP protein Q9LKZ3 original sequence version: 93 F3CD279ED508C263 ckb11_arath Cyclin-dependent kinase B1-1 CDKB1-1 At3g54180 F24B22.140 CDC2B Cell division control protein 2 homolog B protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEKYEKLEKVGEGTYGKVYKAMEKGTGKLVALKKTRLEMDEEGIPPTALREISLLQMLSTSIYVVRLLCVEHVHQPSTKSQSTKSNLYLVFEYLDTDLKKFIDSYRKGPNPKPLEPFLIQKLMFQLCKGVAHCHSHGVLHRDLKPQNLLLVKDKELLKIADLGLGRAFTVPLKSYTHEIVTLWYRAPEVLLGSTHYSTGVDMWSVGCIFAEMVRRQALFPGDSEFQQLLHIFRLLGTPTEQQWPGVSTLRDWHVYPKWEPQDLTLAVPSLSPQGVDLLTKMLKYNPAERISAKTALDHPYFDSLDKSQF 8FFCD006A9A4A75B shr_arath Protein SHORT-ROOT SHR SGR7 Protein SHOOT GRAVITROPISM 7 At4g37650 F19F18.140 GRAS family protein 26 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDTLFRLVSLQQQQQSDSIITNQSSLSRTSTTTTGSPQTAYHYNFPQNDVVEECFNFFMDEEDLSSSSSHHNHHNHNNPNTYYSPFTTPTQYHPATSSTPSSTAAAAALASPYSSSGHHNDPSAFSIPQTPPSFDFSANAKWADSVLLEAARAFSDKDTARAQQILWTLNELSSPYGDTEQKLASYFLQALFNRMTGSGERCYRTMVTAAATEKTCSFESTRKTVLKFQEVSPWATFGHVAANGAILEAVDGEAKIHIVDISSTFCTQWPTLLEALATRSDDTPHLRLTTVVVANKFVNDQTASHRMMKEIGNRMEKFARLMGVPFKFNIIHHVGDLSEFDLNELDVKPDEVLAINCVGAMHGIASRGSPRDAVISSFRRLRPRIVTVVEEEADLVGEEEGGFDDEFLRGFGECLRWFRVCFESWEESFPRTSNERLMLERAAGRAIVDLVACEPSDSTERRETARKWSRRMRNSGFGAVGYSDEVADDVRALLRRYKEGVWSMVQCPDAAGIFLCWRDQPVVWASAWRPT F43EEC5F7AA0CA1C scr_arath Protein SCARECROW SCR At3g54220 GRAS family protein 20 SGR1 Protein SHOOT GRAVITROPISM 1 F24B22.180 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAESGDFNGGQPPPHSPLRTTSSGSSSSNNRGPPPPPPPPLVMVRKRLASEMSSNPDYNNSSRPPRRVSHLLDSNYNTVTPQQPPSLTAAATVSSQPNPPLSVCGFSGLPVFPSDRGGRNVMMSVQPMDQDSSSSSASPTVWVDAIIRDLIHSSTSVSIPQLIQNVRDIIFPCNPNLGALLEYRLRSLMLLDPSSSSDPSPQTFEPLYQISNNPSPPQQQQQHQQQQQQHKPPPPPIQQQERENSSTDAPPQPETVTATVPAVQTNTAEALRERKEEIKRQKQDEEGLHLLTLLLQCAEAVSADNLEEANKLLLEISQLSTPYGTSAQRVAAYFSEAMSARLLNSCLGIYAALPSRWMPQTHSLKMVSAFQVFNGISPLVKFSHFTANQAIQEAFEKEDSVHIIDLDIMQGLQWPGLFHILASRPGGPPHVRLTGLGTSMEALQATGKRLSDFADKLGLPFEFCPLAEKVGNLDTERLNVRKREAVAVHWLQHSLYDVTGSDAHTLWLLQRLAPKVVTVVEQDLSHAGSFLGRFVEAIHYYSALFDSLGASYGEESEERHVVEQQLLSKEIRNVLAVGGPSRSGEVKFESWREKMQQCGFKGISLAGNAATQATLLLGMFPSDGYTLVDDNGTLKLGWKDLSLLTASAWTPRS 009A4C48C6DA0616 e2fa_arath Transcription factor E2FA E2FA At2g36010 E2F3 E2F4 E2F transcription factor-3 F11F19.8 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSGVVRSSPGSSQPPPPPPHHPPSSPVPVTSTPVIPPIRRHLAFASTKPPFHPSDDYHRFNPSSLSNNNDRSFVHGCGVVDREEDAVVVRSPSRKRKATMDMVVAPSNNGFTSSGFTNIPSSPCQTPRKGGRVNIKSKAKGNKSTPQTPISTNAGSPITLTPSGSCRYDSSLGLLTKKFVNLIKQAKDGMLDLNKAAETLEVQKRRIYDITNVLEGIDLIEKPFKNRILWKGVDACPGDEDADVSVLQLQAEIENLALEEQALDNQIRQTEERLRDLSENEKNQKWLFVTEEDIKSLPGFQNQTLIAVKAPHGTTLEVPDPDEAADHPQRRYRIILRSTMGPIDVYLVSEFEGKFEDTNGSGAAPPACLPIASSSGSTGHHDIEALTVDNPETAIVSHDHPHPQPGDTSDLNYLQEQVGGMLKITPSDVENDESDYWLLSNAEISMTDIWKTDSGIDWDYGIADVSTPPPGMGEIAPTAVDSTPR 838A5AD7A31B035C e2fa-rbr1 4 10 unspecified role unspecified role unspecified role unspecified role 14 unspecified role unspecified role unspecified role unspecified role physical association physical association Fig. 1B scr-shr-10 4 12 unspecified role unspecified role unspecified role unspecified role 13 unspecified role unspecified role unspecified role unspecified role physical association physical association Fig. 1B rbr1-scr 4 13 unspecified role unspecified role unspecified role unspecified role Q9M384:p.[Leu295Ala;Glu299Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain E A Wed May 02 18:29:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu295ala,glu299ala' Tue Jun 30 19:25:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu295Ala;Glu299Ala]' 10 unspecified role unspecified role unspecified role unspecified role physical association physical association Fig. 1B rbr1-scr-2 3 13 unspecified role unspecified role neutral component neutral component region nyfp nYFP mutation analysis mutation analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role neutral component neutral component region cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1C e2fa-rbr1-2 3 14 unspecified role unspecified role neutral component neutral component region nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role neutral component neutral component region cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1C scr-shr-12 3 13 unspecified role unspecified role neutral component neutral component region nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role neutral component neutral component region cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1C scr-rbr1 2 13 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey physical association physical association Fig. 1C rbr1-scr-3 6 13 unspecified role unspecified role neutral component neutral component Q9M384:p.[Leu295Ala;Glu299Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain E A Wed May 02 16:27:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu295ala,glu299ala' Tue Jun 30 18:23:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu295Ala;Glu299Ala]' region renilla-n renilla-n mutation analysis mutation analysis undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role neutral component neutral component region renilla-c renilla-c undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1F scr-shr-13 6 12 unspecified role unspecified role neutral component neutral component region renilla-c renilla-c undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role neutral component neutral component region renilla-n renilla-n undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1F e2fa-rbr1-3 6 10 unspecified role unspecified role neutral component neutral component region renilla-c renilla-c undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role neutral component neutral component region renilla-n renilla-n undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1F cycd6_1-rbr1 3 7 unspecified role unspecified role neutral component neutral component region nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role neutral component neutral component region cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3A e2fc-rbr1-1 3 9 unspecified role unspecified role neutral component neutral component region nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role neutral component neutral component region cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3B cdkb1_1-cycd6_1 5 7 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3C shr-rbr1 5 12 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 5B rbr1-nuc-2 1 8 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait association association Fig. 2G