MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The P1/P2 proteins of the human ribosomal stalk are required for ribosome binding and depurination by ricin in human cells. The P1/P2 proteins of the human ribosomal stalk are required for ribosome binding and depurination by ricin in human cells. FEBS J. (1742-464X) 2012 May KL., Li XP., Martínez-Azorín F., Ballesta JP., Grela P., Tchórzewski M., Tumer NE. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined May KL., Li XP., Martínez-Azorín F., Ballesta JP., Grela P., Tchórzewski M., Tumer NE. FEBS J. (1742-464X) 2012 The P1/P2 proteins of the human ribosomal stalk are required for ribosome binding and depurination by ricin in human cells. The P1/P2 proteins of the human ribosomal stalk are required for ribosome binding and depurination by ricin in human cells. FEBS J. (1742-464X) 2012 May KL., Li XP., Martínez-Azorín F., Ballesta JP., Grela P., Tchórzewski M., Tumer NE. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot May KL., Li XP., Martínez-Azorín F., Ballesta JP., Grela P., Tchórzewski M., Tumer NE. FEBS J. (1742-464X) 2012 rla2_human 60S acidic ribosomal protein P2 RPLP2 RPP2 D11S2243E Renal carcinoma antigen NY-REN-44 Large ribosomal subunit protein P2 protein protein human Homo sapiens Human MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD B5ECFE2510A756BF rla1_human 60S acidic ribosomal protein P1 RPLP1 RRP1 Large ribosomal subunit protein P1 protein protein human Homo sapiens Human MASVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVEPFWPGLFAKALANVNIGSLICNVGAGGPAPAAGAAPAGGPAPSTAAAPAEEKKVEAKKEESEESDDDMGFGLFD 4C282AB8DCA079C8 rici_ricco Ricin protein protein castor bean Ricinus communis Castor bean MKPGGNTIVIWMYAVATWLCFGSTSGWSFTLEDNNIFPKQYPIINFTTAGATVQSYTNFIRAVRGRLTTGADVRHEIPVLPNRVGLPINQRFILVELSNHAELSVTLALDVTNAYVVGYRAGNSAYFFHPDNQEDAEAITHLFTDVQNRYTFAFGGNYDRLEQLAGNLRENIELGNGPLEEAISALYYYSTGGTQLPTLARSFIICIQMISEAARFQYIEGEMRTRIRYNRRSAPDPSVITLENSWGRLSTAIQESNQGAFASPIQLQRRNGSKFSVYDVSILIPIIALMVYRCAPPPSSQFSLLIRPVVPNFNADVCMDPEPIVRIVGRNGLCVDVRDGRFHNGNAIQLWPCKSNTDANQLWTLKRDNTIRSNGKCLTTYGYSPGVYVMIYDCNTAATDATRWQIWDNGTIINPRSSLVLAATSGNSGTTLTVQTNIYAVSQGWLPTNNTQPFVTTIVGLYGLCLQANSGQVWIEDCSSEKAEQQWALYADGSIRPQQNRDNCLTSDSNIRETVVKILSCGPASSGQRWMFKNDGTILNLYSGLVLDVRASDPSLKQIILYPLHGDPNQIWLPLF DIP protein P02879 original sequence version: 109 mint C14C4B77A8B5470D rici-rplp1 1 RTA 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ricin a chain Ricin A chain polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain P2 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified P1 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified physical association physical association f5a mint RTA was immobilized on a carboxymethylated dextran chip (CM5) via amine coupling and recombinant human P1/P2 heterodimer [38] was passed over the surface. Human P1/P2 rapidly associated with RTA, while no significant interaction could be detected with a control protein (EGFP) (Fig. 5A). rici-rplp1-1 2 RTA 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified ricin a chain Ricin A chain polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P1 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified P2 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified physical association physical association f5b mint