IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ ASXL1 Mutations Promote Myeloid Transformation through Loss of PRC2-Mediated Gene Repression. ASXL1 Mutations Promote Myeloid Transformation through Loss of PRC2-Mediated Gene Repression. Cancer Cell (1535-6108) 2012 imex curation Abdel-Wahab O., Adli M., Lafave L.M., Gao J., Hricik T., Shih A.H., Pandey S., Patel J.P., Chung Y.R., Koche R., Perna F., Zhao X., Taylor J.E., Park C.Y., Carroll M., Melnick A., Nimer S.D., Jaffe J.D., Aifantis I., Bernstein B.E., Levine R.L. Cancer - Interactions investigated in the context of cancer This paper appears to give location of mutations/frameshift location/premature stop etc...in many cell lines for ASXL1 (e.g. NOMO1=R639X, K562 = Y591Y/X) but there is no "R" at position 639 in ASXL1, and as the mutants are also stated to to "have reduced or absent ASXL1 protein expression" - I have ignored this "info")) (truncated proteins expressed are stated to be unstable) chIP data for Histone 3 cannot be entered due to lack of antibody specificity. bernstein.bradley@mgh.harvard.edu, leviner@mskcc.org 15-Nov-2012: Contacted by pporras. Only protein-protein interactions human-k_562 Homo sapiens myeloid leukemia cells. k562 Myelogenous leukemia K562 cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Abdel-Wahab O., Adli M., Lafave L.M., Gao J., Hricik T., Shih A.H., Pandey S., Patel J.P., Chung Y.R., Koche R., Perna F., Zhao X., Taylor J.E., Park C.Y., Carroll M., Melnick A., Nimer S.D., Jaffe J.D., Aifantis I., Bernstein B.E., Levine R.L. Cancer - Interactions investigated in the context of cancer This paper appears to give location of mutations/frameshift location/premature stop etc...in many cell lines for ASXL1 (e.g. NOMO1=R639X, K562 = Y591Y/X) but there is no "R" at position 639 in ASXL1, and as the mutants are also stated to to "have reduced or absent ASXL1 protein expression" - I have ignored this "info")) (truncated proteins expressed are stated to be unstable) chIP data for Histone 3 cannot be entered due to lack of antibody specificity. bernstein.bradley@mgh.harvard.edu, leviner@mskcc.org Accepted 2012-OCT-09 by PPORRAS 15-Nov-2012: Contacted by pporras. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation ASXL1 Mutations Promote Myeloid Transformation through Loss of PRC2-Mediated Gene Repression. ASXL1 Mutations Promote Myeloid Transformation through Loss of PRC2-Mediated Gene Repression. Cancer Cell (1535-6108) 2012 imex curation Abdel-Wahab O., Adli M., Lafave L.M., Gao J., Hricik T., Shih A.H., Pandey S., Patel J.P., Chung Y.R., Koche R., Perna F., Zhao X., Taylor J.E., Park C.Y., Carroll M., Melnick A., Nimer S.D., Jaffe J.D., Aifantis I., Bernstein B.E., Levine R.L. Cancer - Interactions investigated in the context of cancer This paper appears to give location of mutations/frameshift location/premature stop etc...in many cell lines for ASXL1 (e.g. NOMO1=R639X, K562 = Y591Y/X) but there is no "R" at position 639 in ASXL1, and as the mutants are also stated to to "have reduced or absent ASXL1 protein expression" - I have ignored this "info")) (truncated proteins expressed are stated to be unstable) chIP data for Histone 3 cannot be entered due to lack of antibody specificity. bernstein.bradley@mgh.harvard.edu, leviner@mskcc.org 15-Nov-2012: Contacted by pporras. Only protein-protein interactions human-set2 SET2 - Human acute leukemia cell line (megakaryoblastic) set2 SET2 Human acute leukemia cell line (megakaryoblastic) ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Abdel-Wahab O., Adli M., Lafave L.M., Gao J., Hricik T., Shih A.H., Pandey S., Patel J.P., Chung Y.R., Koche R., Perna F., Zhao X., Taylor J.E., Park C.Y., Carroll M., Melnick A., Nimer S.D., Jaffe J.D., Aifantis I., Bernstein B.E., Levine R.L. Cancer - Interactions investigated in the context of cancer This paper appears to give location of mutations/frameshift location/premature stop etc...in many cell lines for ASXL1 (e.g. NOMO1=R639X, K562 = Y591Y/X) but there is no "R" at position 639 in ASXL1, and as the mutants are also stated to to "have reduced or absent ASXL1 protein expression" - I have ignored this "info")) (truncated proteins expressed are stated to be unstable) chIP data for Histone 3 cannot be entered due to lack of antibody specificity. bernstein.bradley@mgh.harvard.edu, leviner@mskcc.org Accepted 2012-OCT-09 by PPORRAS 15-Nov-2012: Contacted by pporras. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation ASXL1 Mutations Promote Myeloid Transformation through Loss of PRC2-Mediated Gene Repression. ASXL1 Mutations Promote Myeloid Transformation through Loss of PRC2-Mediated Gene Repression. Cancer Cell (1535-6108) 2012 imex curation Abdel-Wahab O., Adli M., Lafave L.M., Gao J., Hricik T., Shih A.H., Pandey S., Patel J.P., Chung Y.R., Koche R., Perna F., Zhao X., Taylor J.E., Park C.Y., Carroll M., Melnick A., Nimer S.D., Jaffe J.D., Aifantis I., Bernstein B.E., Levine R.L. Cancer - Interactions investigated in the context of cancer This paper appears to give location of mutations/frameshift location/premature stop etc...in many cell lines for ASXL1 (e.g. NOMO1=R639X, K562 = Y591Y/X) but there is no "R" at position 639 in ASXL1, and as the mutants are also stated to to "have reduced or absent ASXL1 protein expression" - I have ignored this "info")) (truncated proteins expressed are stated to be unstable) chIP data for Histone 3 cannot be entered due to lack of antibody specificity. bernstein.bradley@mgh.harvard.edu, leviner@mskcc.org 15-Nov-2012: Contacted by pporras. Only protein-protein interactions human-nomo-1 human nomo-1 nomo-1 NOMO-1 Human AML cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Abdel-Wahab O., Adli M., Lafave L.M., Gao J., Hricik T., Shih A.H., Pandey S., Patel J.P., Chung Y.R., Koche R., Perna F., Zhao X., Taylor J.E., Park C.Y., Carroll M., Melnick A., Nimer S.D., Jaffe J.D., Aifantis I., Bernstein B.E., Levine R.L. Cancer - Interactions investigated in the context of cancer This paper appears to give location of mutations/frameshift location/premature stop etc...in many cell lines for ASXL1 (e.g. NOMO1=R639X, K562 = Y591Y/X) but there is no "R" at position 639 in ASXL1, and as the mutants are also stated to to "have reduced or absent ASXL1 protein expression" - I have ignored this "info")) (truncated proteins expressed are stated to be unstable) chIP data for Histone 3 cannot be entered due to lack of antibody specificity. bernstein.bradley@mgh.harvard.edu, leviner@mskcc.org Accepted 2012-OCT-09 by PPORRAS 15-Nov-2012: Contacted by pporras. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation ASXL1 Mutations Promote Myeloid Transformation through Loss of PRC2-Mediated Gene Repression. ASXL1 Mutations Promote Myeloid Transformation through Loss of PRC2-Mediated Gene Repression. Cancer Cell (1535-6108) 2012 imex curation Abdel-Wahab O., Adli M., Lafave L.M., Gao J., Hricik T., Shih A.H., Pandey S., Patel J.P., Chung Y.R., Koche R., Perna F., Zhao X., Taylor J.E., Park C.Y., Carroll M., Melnick A., Nimer S.D., Jaffe J.D., Aifantis I., Bernstein B.E., Levine R.L. Cancer - Interactions investigated in the context of cancer This paper appears to give location of mutations/frameshift location/premature stop etc...in many cell lines for ASXL1 (e.g. NOMO1=R639X, K562 = Y591Y/X) but there is no "R" at position 639 in ASXL1, and as the mutants are also stated to to "have reduced or absent ASXL1 protein expression" - I have ignored this "info")) (truncated proteins expressed are stated to be unstable) chIP data for Histone 3 cannot be entered due to lack of antibody specificity. bernstein.bradley@mgh.harvard.edu, leviner@mskcc.org 15-Nov-2012: Contacted by pporras. Only protein-protein interactions human-uke1 HUMAN UKE1 - (secondary acute) myeloid leukemic cell line uke1 UKE1 Human (secondary acute) myeloid leukemia cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Abdel-Wahab O., Adli M., Lafave L.M., Gao J., Hricik T., Shih A.H., Pandey S., Patel J.P., Chung Y.R., Koche R., Perna F., Zhao X., Taylor J.E., Park C.Y., Carroll M., Melnick A., Nimer S.D., Jaffe J.D., Aifantis I., Bernstein B.E., Levine R.L. Cancer - Interactions investigated in the context of cancer This paper appears to give location of mutations/frameshift location/premature stop etc...in many cell lines for ASXL1 (e.g. NOMO1=R639X, K562 = Y591Y/X) but there is no "R" at position 639 in ASXL1, and as the mutants are also stated to to "have reduced or absent ASXL1 protein expression" - I have ignored this "info")) (truncated proteins expressed are stated to be unstable) Human AML cells from from four different cell lines, two of these express ASXL1 (UKE1 and SET2), and two either do not express ASXL1 - or express it at a much reduced level (NOMO1 and K562). chIP data for Histone 3 cannot be entered due to lack of antibody specificity. bernstein.bradley@mgh.harvard.edu, leviner@mskcc.org Accepted 2012-OCT-09 by PPORRAS 15-Nov-2012: Contacted by pporras. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation ASXL1 Mutations Promote Myeloid Transformation through Loss of PRC2-Mediated Gene Repression. ASXL1 Mutations Promote Myeloid Transformation through Loss of PRC2-Mediated Gene Repression. Cancer Cell (1535-6108) 2012 imex curation Abdel-Wahab O., Adli M., Lafave L.M., Gao J., Hricik T., Shih A.H., Pandey S., Patel J.P., Chung Y.R., Koche R., Perna F., Zhao X., Taylor J.E., Park C.Y., Carroll M., Melnick A., Nimer S.D., Jaffe J.D., Aifantis I., Bernstein B.E., Levine R.L. Cancer - Interactions investigated in the context of cancer This paper appears to give location of mutations/frameshift location/premature stop etc...in many cell lines for ASXL1 (e.g. NOMO1=R639X, K562 = Y591Y/X) but there is no "R" at position 639 in ASXL1, and as the mutants are also stated to to "have reduced or absent ASXL1 protein expression" - I have ignored this "info")) (truncated proteins expressed are stated to be unstable) chIP data for Histone 3 cannot be entered due to lack of antibody specificity. bernstein.bradley@mgh.harvard.edu, leviner@mskcc.org 15-Nov-2012: Contacted by pporras. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Abdel-Wahab O., Adli M., Lafave L.M., Gao J., Hricik T., Shih A.H., Pandey S., Patel J.P., Chung Y.R., Koche R., Perna F., Zhao X., Taylor J.E., Park C.Y., Carroll M., Melnick A., Nimer S.D., Jaffe J.D., Aifantis I., Bernstein B.E., Levine R.L. Cancer - Interactions investigated in the context of cancer This paper appears to give location of mutations/frameshift location/premature stop etc...in many cell lines for ASXL1 (e.g. NOMO1=R639X, K562 = Y591Y/X) but there is no "R" at position 639 in ASXL1, and as the mutants are also stated to to "have reduced or absent ASXL1 protein expression" - I have ignored this "info")) (truncated proteins expressed are stated to be unstable) chIP data for Histone 3 cannot be entered due to lack of antibody specificity. bernstein.bradley@mgh.harvard.edu, leviner@mskcc.org Accepted 2012-OCT-09 by PPORRAS 15-Nov-2012: Contacted by pporras. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation ASXL1 Mutations Promote Myeloid Transformation through Loss of PRC2-Mediated Gene Repression. ASXL1 Mutations Promote Myeloid Transformation through Loss of PRC2-Mediated Gene Repression. Cancer Cell (1535-6108) 2012 imex curation Abdel-Wahab O., Adli M., Lafave L.M., Gao J., Hricik T., Shih A.H., Pandey S., Patel J.P., Chung Y.R., Koche R., Perna F., Zhao X., Taylor J.E., Park C.Y., Carroll M., Melnick A., Nimer S.D., Jaffe J.D., Aifantis I., Bernstein B.E., Levine R.L. Cancer - Interactions investigated in the context of cancer This paper appears to give location of mutations/frameshift location/premature stop etc...in many cell lines for ASXL1 (e.g. NOMO1=R639X, K562 = Y591Y/X) but there is no "R" at position 639 in ASXL1, and as the mutants are also stated to to "have reduced or absent ASXL1 protein expression" - I have ignored this "info")) (truncated proteins expressed are stated to be unstable) chIP data for Histone 3 cannot be entered due to lack of antibody specificity. bernstein.bradley@mgh.harvard.edu, leviner@mskcc.org 15-Nov-2012: Contacted by pporras. Only protein-protein interactions human-nomo-1 human nomo-1 nomo-1 NOMO-1 Human AML cell line ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Abdel-Wahab O., Adli M., Lafave L.M., Gao J., Hricik T., Shih A.H., Pandey S., Patel J.P., Chung Y.R., Koche R., Perna F., Zhao X., Taylor J.E., Park C.Y., Carroll M., Melnick A., Nimer S.D., Jaffe J.D., Aifantis I., Bernstein B.E., Levine R.L. Cancer - Interactions investigated in the context of cancer The interaction with the HOXA8 gene cannot be entered as this gene does not exist (in vertebrates) - see UniProt hoxlist.txt Release 2012_09. This paper appears to give location of mutations/frameshift location/premature stop etc...in many cell lines for ASXL1 (e.g. NOMO1=R639X, K562 = Y591Y/X) but there is no "R" at position 639 in ASXL1, and as the mutants are also stated to to "have reduced or absent ASXL1 protein expression" - I have ignored this "info")) (truncated proteins expressed are stated to be unstable) chIP data for Histone 3 cannot be entered due to lack of antibody specificity. bernstein.bradley@mgh.harvard.edu, leviner@mskcc.org Accepted 2012-OCT-09 by PPORRAS 15-Nov-2012: Contacted by pporras. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation ASXL1 Mutations Promote Myeloid Transformation through Loss of PRC2-Mediated Gene Repression. ASXL1 Mutations Promote Myeloid Transformation through Loss of PRC2-Mediated Gene Repression. Cancer Cell (1535-6108) 2012 imex curation Abdel-Wahab O., Adli M., Lafave L.M., Gao J., Hricik T., Shih A.H., Pandey S., Patel J.P., Chung Y.R., Koche R., Perna F., Zhao X., Taylor J.E., Park C.Y., Carroll M., Melnick A., Nimer S.D., Jaffe J.D., Aifantis I., Bernstein B.E., Levine R.L. Cancer - Interactions investigated in the context of cancer This paper appears to give location of mutations/frameshift location/premature stop etc...in many cell lines for ASXL1 (e.g. NOMO1=R639X, K562 = Y591Y/X) but there is no "R" at position 639 in ASXL1, and as the mutants are also stated to to "have reduced or absent ASXL1 protein expression" - I have ignored this "info")) (truncated proteins expressed are stated to be unstable) chIP data for Histone 3 cannot be entered due to lack of antibody specificity. bernstein.bradley@mgh.harvard.edu, leviner@mskcc.org 15-Nov-2012: Contacted by pporras. Only protein-protein interactions human-set2 SET2 - Human acute leukemia cell line (megakaryoblastic) set2 SET2 Human acute leukemia cell line (megakaryoblastic) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Abdel-Wahab O., Adli M., Lafave L.M., Gao J., Hricik T., Shih A.H., Pandey S., Patel J.P., Chung Y.R., Koche R., Perna F., Zhao X., Taylor J.E., Park C.Y., Carroll M., Melnick A., Nimer S.D., Jaffe J.D., Aifantis I., Bernstein B.E., Levine R.L. Cancer - Interactions investigated in the context of cancer This paper appears to give location of mutations/frameshift location/premature stop etc...in many cell lines for ASXL1 (e.g. NOMO1=R639X, K562 = Y591Y/X) but there is no "R" at position 639 in ASXL1, and as the mutants are also stated to to "have reduced or absent ASXL1 protein expression" - I have ignored this "info")) (truncated proteins expressed are stated to be unstable) chIP data for Histone 3 cannot be entered due to lack of antibody specificity. bernstein.bradley@mgh.harvard.edu, leviner@mskcc.org Accepted 2012-OCT-09 by PPORRAS 15-Nov-2012: Contacted by pporras. Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation ezh2_human Histone-lysine N-methyltransferase EZH2 KMT6 Enhancer of zeste homolog 2 ENX-1 Lysine N-methyltransferase 6 EZH2 protein protein human Homo sapiens Human MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPNNSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPAPAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP DIP protein Q15910 original sequence version: 97 DIP protein Q15910 original sequence version: 94 DIP protein Q15910 original sequence version: 92 DIP protein Q15910 original sequence version: 96 DIP protein Q15910 original sequence version: 122 DIP protein Q15910 original sequence version: 100 1B5029EB9D509BE5 ring1_human E3 ubiquitin-protein ligase RING1 RING finger protein 1 Polycomb complex protein RING1 RING1 RNF1 Really interesting new gene 1 protein RING-type E3 ubiquitin transferase RING1 protein protein human Homo sapiens Human MTTPANAQNASKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPIPGSDQTTTMSGGEGEPGEGEGDGEDVSSDSAPDSAPGPAPKRPRGGGAGGSSVGTGGGGTGGVGGGAGSEDSGDRGGTLGGGTLGPPSPPGAPSPPEPGGEIELVFRPHPLLVEKGEYCQTRYVKTTGNATVDHLSKYLALRIALERRQQQEAGEPGGPGGGASDTGGPDGCGGEGGGAGGGDGPEEPALPSLEGVSEKQYTIYIAPGGGAFTTLNGSLTLELVNEKFWKVSRPLELCYAPTKDPK DIP protein Q06587 original sequence version: 103 DIP protein Q06587 original sequence version: 147 DIP protein Q06587 original sequence version: 135 6959787479DE9DAB asxl1_human Polycomb group protein ASXL1 ASXL1 KIAA0978 Additional sex combs-like protein 1 protein protein human Homo sapiens Human MKDKQKKKKERTWAEAARLVLENYSDAPMTPKQILQVIEAEGLKEMRSGTSPLACLNAMLHSNSRGGEGLFYKLPGRISLFTLKKDALQWSRHPATVEGEEPEDTADVESCGSNEASTVSGENDVSLDETSSNASCSTESQSRPLSNPRDSYRASSQANKQKKKTGVMLPRVVLTPLKVNGAHVESASGFSGCHADGESGSPSSSSSGSLALGSAAIRGQAEVTQDPAPLLRGFRKPATGQMKRNRGEEIDFETPGSILVNTNLRALINSRTFHALPSHFQQQLLFLLPEVDRQVGTDGLLRLSSSALNNEFFTHAAQSWRERLADGEFTHEMQVRIRQEMEKEKKVEQWKEKFFEDYYGQKLGLTKEESLQQNVGQEEAEIKSGLCVPGESVRIQRGPATRQRDGHFKKRSRPDLRTRARRNLYKKQESEQAGVAKDAKSVASDVPLYKDGEAKTDPAGLSSPHLPGTSSAAPDLEGPEFPVESVASRIQAEPDNLARASASPDRIPSLPQETVDQEPKDQKRKSFEQAASASFPEKKPRLEDRQSFRNTIESVHTEKPQPTKEEPKVPPIRIQLSRIKPPWVVKGQPTYQICPRIIPTTESSCRGWTGARTLADIKARALQVRGARGHHCHREAATTAIGGGGGPGGGGGGATDEGGGRGSSSGDGGEACGHPEPRGGPSTPGKCTSDLQRTQLLPPYPLNGEHTQAGTAMSRARREDLPSLRKEESCLLQRATVGLTDGLGDASQLPVAPTGDQPCQALPLLSSQTSVAERLVEQPQLHPDVRTECESGTTSWESDDEEQGPTVPADNGPIPSLVGDDTLEKGTGQALDSHPTMKDPVNVTPSSTPESSPTDCLQNRAFDDELGLGGSCPPMRESDTRQENLKTKALVSNSSLHWIPIPSNDEVVKQPKPESREHIPSVEPQVGEEWEKAAPTPPALPGDLTAEEGLDPLDSLTSLWTVPSRGGSDSNGSYCQQVDIEKLKINGDSEALSPHGESTDTASDFEGHLTEDSSEADTREAAVTKGSSVDKDEKPNWNQSAPLSKVNGDMRLVTRTDGMVAPQSWVSRVCAVRQKIPDSLLLASTEYQPRAVCLSMPGSSVEATNPLVMQLLQGSLPLEKVLPPAHDDSMSESPQVPLTKDQSHGSLRMGSLHGLGKNSGMVDGSSPSSLRALKEPLLPDSCETGTGLARIEATQAPGAPQKNCKAVPSFDSLHPVTNPITSSRKLEEMDSKEQFSSFSCEDQKEVRAMSQDSNSNAAPGKSPGDLTTSRTPRFSSPNVISFGPEQTGRALGDQSNVTGQGKKLFGSGNVAATLQRPRPADPMPLPAEIPPVFPSGKLGPSTNSMSGGVQTPREDWAPKPHAFVGSVKNEKTFVGGPLKANAENRKATGHSPLELVGHLEGMPFVMDLPFWKLPREPGKGLSEPLEPSSLPSQLSIKQAFYGKLSKLQLSSTSFNYSSSSPTFPKGLAGSVVQLSHKANFGASHSASLSLQMFTDSSTVESISLQCACSLKAMIMCQGCGAFCHDDCIGPSKLCVLCLVVR DIP protein Q8IXJ9 original sequence version: 71 DIP protein Q8IXJ9 original sequence version: 91 8FCE072F3295AA34 hxa6_human_gene HOXA6 Human Gene gene gene human Homo sapiens Human hxa10_human_gene HOXA10 Human Gene gene gene human Homo sapiens Human bmi1_human Polycomb complex protein BMI-1 BMI1 PCGF4 RNF51 Polycomb group RING finger protein 4 RING finger protein 51 protein protein human Homo sapiens Human MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG DIP protein P35226 original sequence version: 105 DIP protein P35226 original sequence version: 136 DIP protein P35226 original sequence version: 110 DIP protein P35226 original sequence version: 129 030A7D396BADA543 bap1_human Ubiquitin carboxyl-terminal hydrolase BAP1 BAP1 KIAA0272 hucep-6 BRCA1-associated protein 1 Cerebral protein 6 protein protein human Homo sapiens Human MNKGWLELESDPGLFTLLVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLFKWIEERRSRRKVSTLVDDTSVIDDDIVNNMFFAHQLIPNSCATHALLSVLLNCSSVDLGPTLSRMKDFTKGFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSYVPITGRLFELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRFNLMAVVPDRRIKYEARLHVLKVNRQTVLEALQQLIRVTQPELIQTHKSQESQLPEESKSASNKSPLVLEANRAPAASEGNHTDGAEEAAGSCAQAPSHSPPNKPKLVVKPPGSSLNGVHPNPTPIVQRLPAFLDNHNYAKSPMQEEEDLAAGVGRSRVPVRPPQQYSDDEDDYEDDEEDDVQNTNSALRYKGKGTGKPGALSGSADGQLSVLQPNTINVLAEKLKESQKDLSIPLSIKTSSGAGSPAVAVPTHSQPSPTPSNESTDTASEIGSAFNSPLRSPIRSANPTRPSSPVTSHISKVLFGEDDSLLRVDCIRYNRAVRDLGPVISTGLLHLAEDGVLSPLALTEGGKGSSPSIRPIQGSQGSSSPVEKEVVEATDSREKTGMVRPGEPLSGEKYSPKELLALLKCVEAEIANYEACLKEEVEKRKKFKIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKPDRRKRSRPYKAKRQ DIP protein Q92560 original sequence version: 79 031DA03AE1841D85 hxa11_human_gene HOXA11 Human Gene gene gene human Homo sapiens Human eed_human Polycomb protein EED EED WD protein associating with integrin cytoplasmic tails 1 Embryonic ectoderm development protein protein protein human Homo sapiens Human MSEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR DIP protein O75530 original sequence version: 70 DIP protein O75530-1 original sequence version: 78 DIP protein O75530 original sequence version: 78 DIP protein O75530 original sequence version: 73 DIP protein O75530-1 original sequence version: 89 DIP protein O75530-1 original sequence version: 87 DIP protein O75530 original sequence version: 77 D2E0A5BA27C0499A hxa9_human_gene HumanHomeobox protein Hox-A9 gene gene gene human Homo sapiens Human hxa7_human_gene HOXA7 Human Gene gene gene human Homo sapiens Human hxa5_human_gene HOXA5 Human Gene gene gene human Homo sapiens Human suz12_human Polycomb protein SUZ12 CHET9 JJAZ1 KIAA0160 SUZ12 Suppressor of zeste 12 protein homolog Joined to JAZF1 protein Chromatin precipitated E2F target 9 protein protein protein human Homo sapiens Human MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTNIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQNSVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEELPARRKRNREDGEKTFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLRWTGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPNENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKGESASPANEEITEEQNGTANGFSEINSKEKALETDSVSGVSKQSKKQKL DIP protein Q15022 original sequence version: 92 DIP protein Q15022 original sequence version: 88 DIP protein Q15022 original sequence version: 91 DIP protein Q15022 original sequence version: 106 A8830EBC3FD38D56 bap1-asxl1-1 4 14 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association Fig 2A An association was observed in cell lines with wild-type ASXL1 (UKE1 and SET2) and but not in those cells with reduced or absent ASXL1 expression (NOMO1 and K562). ezh2-hxa10 2 12 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait association association Fig 5E ASXL1 deletion results in loss of binding of EZH2. ezh2-hxa11 2 8 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey association association Fig 5E ASXL1 deletion results in loss of binding of EZH2. asxl1-ezh2-1 5 8 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role prey prey association association Fig 6A asxl1-ezh2-2 7 8 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Fig 6B ezh2-asxl1 7 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Fig 6B ezh2-asxl1-1 4 16 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait association association Fig 6C, S5. An association with ASXL1, EZH2 and EED was observed in cell lines with wild-type ASXL1 (UKE1 and SET2) but only with EZH2 and EED in those cells with reduced or absent ASXL1 expression (NOMO1 and K562). eed-asxl1 4 10 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait physical association physical association Fig 6C-2 All four cell lines appeared to give a positive result for this interaction. bmi1-ring1-3 4 9 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association Fig 6C asxl1-bap1 5 14 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain association association Fig S2A Nonsense mutation in ASXL1 results in partial (629X) or complete (936X) loss of binding. bmi1-ring1-4 7 9 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association Fig 6C bap1-asxl1-2 7 14 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association Fig 2A An association was observed in cell lines with wild-type ASXL1 (UKE1 and SET2) and but not in those cells with reduced or absent ASXL1 expression (NOMO1 and K562). ezh2-asxl1-2 7 8 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey association association Fig 6C An association with ASXL1, EZH2 and EED was observed in cell lines with wild-type ASXL1 (UKE1 and SET2) but only with EZH2 and EED in those cells with reduced or absent ASXL1 expression (NOMO1 and K562). eed-asxl1-1 7 16 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association Fig 6C-2 All four cell lines appeared to give a positive result for this interaction. asxl1-ezh2-5 3 8 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey physical association physical association Fig 6C An association with ASXL1, EZH2 and EED was observed in cell lines with wild-type ASXL1 (UKE1 and SET2) but only with EZH2 and EED in those cells with reduced or absent ASXL1 expression (NOMO1 and K562). eed-asxl1-2 3 16 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association Fig 6C-2 All four cell lines appeared to give a positive result for this interaction. bmi1-ring1-5 3 13 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association Fig 6C bmi1-ring1-6 1 9 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association Fig 6C eed-asxl1-3 1 10 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait physical association physical association Fig 6C-2 All four cell lines appeared to give a positive result for this interaction. asxl1-ezh2-6 1 8 unspecified role unspecified role bait bait 16 unspecified role unspecified role prey prey physical association physical association Fig 6C An association with ASXL1, EZH2 and EED was observed in cell lines with wild-type ASXL1 (UKE1 and SET2) but only with EZH2 and EED in those cells with reduced or absent ASXL1 expression (NOMO1 and K562). asxl1-eed-1 4 10 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey association association Fig S5. IP of ASXL1 did not reveal pulldown of BMI1 in UKE1 cells. ezh2-hxa11-1 6 10 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey association association 4E ezh2-hxa10-1 6 10 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey association association 4E asxl1-hxa9 6 10 unspecified role unspecified role bait bait 17 unspecified role unspecified role prey prey association association 4E asxl1-hxa9-1 6 19 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait association association 4E asxl1-hxa5 6 11 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait association association 4E asxl1-hxa6 6 10 unspecified role unspecified role bait bait 18 unspecified role unspecified role prey prey association association 4E