MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Ubiquitin-specific protease-like 1 (USPL1) is a SUMO isopeptidase with essential, non-catalytic functions. Ubiquitin-specific protease-like 1 (USPL1) is a SUMO isopeptidase with essential, non-catalytic functions. EMBO Rep. (1469-221X) 2012 imex curation Schulz S., Chachami G., Kozaczkiewicz L., Winter U., Stankovic-Valentin N., Haas P., Hofmann K., Urlaub H., Ovaa H., Wittbrodt J., Meulmeester E., Melchior F. Only protein-protein interactions in vitro In vitro comigration in gel comigration in gel electrophoresis comigration in gel weight by comassie molecular weight estimation by coomasie staining weight by comassie Schulz S., Chachami G., Kozaczkiewicz L., Winter U., Stankovic-Valentin N., Haas P., Hofmann K., Urlaub H., Ovaa H., Wittbrodt J., Meulmeester E., Melchior F. EMBO Rep. (1469-221X) 2012 Only protein-protein interactions imex curation Ubiquitin-specific protease-like 1 (USPL1) is a SUMO isopeptidase with essential, non-catalytic functions. Ubiquitin-specific protease-like 1 (USPL1) is a SUMO isopeptidase with essential, non-catalytic functions. EMBO Rep. (1469-221X) 2012 imex curation Schulz S., Chachami G., Kozaczkiewicz L., Winter U., Stankovic-Valentin N., Haas P., Hofmann K., Urlaub H., Ovaa H., Wittbrodt J., Meulmeester E., Melchior F. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip experimental particp experimental participant identification experimental particp Schulz S., Chachami G., Kozaczkiewicz L., Winter U., Stankovic-Valentin N., Haas P., Hofmann K., Urlaub H., Ovaa H., Wittbrodt J., Meulmeester E., Melchior F. EMBO Rep. (1469-221X) 2012 Only protein-protein interactions imex curation Ubiquitin-specific protease-like 1 (USPL1) is a SUMO isopeptidase with essential, non-catalytic functions. Ubiquitin-specific protease-like 1 (USPL1) is a SUMO isopeptidase with essential, non-catalytic functions. EMBO Rep. (1469-221X) 2012 imex curation Schulz S., Chachami G., Kozaczkiewicz L., Winter U., Stankovic-Valentin N., Haas P., Hofmann K., Urlaub H., Ovaa H., Wittbrodt J., Meulmeester E., Melchior F. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink weight by comassie molecular weight estimation by coomasie staining weight by comassie Schulz S., Chachami G., Kozaczkiewicz L., Winter U., Stankovic-Valentin N., Haas P., Hofmann K., Urlaub H., Ovaa H., Wittbrodt J., Meulmeester E., Melchior F. EMBO Rep. (1469-221X) 2012 Only protein-protein interactions imex curation Ubiquitin-specific protease-like 1 (USPL1) is a SUMO isopeptidase with essential, non-catalytic functions. Ubiquitin-specific protease-like 1 (USPL1) is a SUMO isopeptidase with essential, non-catalytic functions. EMBO Rep. (1469-221X) 2012 imex curation Schulz S., Chachami G., Kozaczkiewicz L., Winter U., Stankovic-Valentin N., Haas P., Hofmann K., Urlaub H., Ovaa H., Wittbrodt J., Meulmeester E., Melchior F. Only protein-protein interactions in vitro In vitro pull down pull down experimental particp experimental participant identification experimental particp Schulz S., Chachami G., Kozaczkiewicz L., Winter U., Stankovic-Valentin N., Haas P., Hofmann K., Urlaub H., Ovaa H., Wittbrodt J., Meulmeester E., Melchior F. EMBO Rep. (1469-221X) 2012 Only protein-protein interactions imex curation Ubiquitin-specific protease-like 1 (USPL1) is a SUMO isopeptidase with essential, non-catalytic functions. Ubiquitin-specific protease-like 1 (USPL1) is a SUMO isopeptidase with essential, non-catalytic functions. EMBO Rep. (1469-221X) 2012 imex curation Schulz S., Chachami G., Kozaczkiewicz L., Winter U., Stankovic-Valentin N., Haas P., Hofmann K., Urlaub H., Ovaa H., Wittbrodt J., Meulmeester E., Melchior F. Only protein-protein interactions in vitro In vitro enzymatic study enzymatic study experimental particp experimental participant identification experimental particp Schulz S., Chachami G., Kozaczkiewicz L., Winter U., Stankovic-Valentin N., Haas P., Hofmann K., Urlaub H., Ovaa H., Wittbrodt J., Meulmeester E., Melchior F. EMBO Rep. (1469-221X) 2012 Only protein-protein interactions imex curation Ubiquitin-specific protease-like 1 (USPL1) is a SUMO isopeptidase with essential, non-catalytic functions. Ubiquitin-specific protease-like 1 (USPL1) is a SUMO isopeptidase with essential, non-catalytic functions. EMBO Rep. (1469-221X) 2012 imex curation Schulz S., Chachami G., Kozaczkiewicz L., Winter U., Stankovic-Valentin N., Haas P., Hofmann K., Urlaub H., Ovaa H., Wittbrodt J., Meulmeester E., Melchior F. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging experimental particp experimental participant identification experimental particp Schulz S., Chachami G., Kozaczkiewicz L., Winter U., Stankovic-Valentin N., Haas P., Hofmann K., Urlaub H., Ovaa H., Wittbrodt J., Meulmeester E., Melchior F. EMBO Rep. (1469-221X) 2012 Only protein-protein interactions imex curation coil_human Coilin COIL CLN80 p80-coilin protein protein human Homo sapiens Human MAASETVRLRLQFDYPPPATPHCTAFWLLVDLNRCRVVTDLISLIRQRFGFSSGAFLGLYLEGGLLPPAESARLVRDNDCLRVKLEERGVAENSVVISNGDINLSLRKAKKRAFQLEEGEETEPDCKYSKKHWKSRENNNNNEKVLDLEPKAVTDQTVSKKNKRKNKATCGTVGDDNEEAKRKSPKKKEKCEYKKKAKNPKSPKVQAVKDWANQRCSSPKGSARNSLVKAKRKGSVSVCSKESPSSSSESESCDESISDGPSKVTLEARNSSEKLPTELSKEEPSTKNTTADKLAIKLGFSLTPSKGKTSGTTSSSSDSSAESDDQCLMSSSTPECAAGFLKTVGLFAGRGRPGPGLSSQTAGAAGWRRSGSNGGGQAPGASPSVSLPASLGRGWGREENLFSWKGAKGRGMRGRGRGRGHPVSCVVNRSTDNQRQQQLNDVVKNSSTIIQNPVETPKKDYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQVDIEILSSLPALREPGKFDLVYHNENGAEVVEYAVTQESKITVFWKELIDPRLIIESPSNTSSTEPA DIP protein P38432 original sequence version: 96 879702B590F16849 sumo1_human Small ubiquitin-related modifier 1 SUMO1 Sentrin Ubiquitin-like protein SMT3C Ubiquitin-homology domain protein PIC1 Ubiquitin-like protein UBL1 GAP-modifying protein 1 SMT3 homolog 3 SMT3C SMT3H3 UBL1 OK/SW-cl.43 protein protein human Homo sapiens Human MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV DIP protein P63165 original sequence version: 36 DIP protein P63165 original sequence version: 40 DIP protein P63165 original sequence version: 124 DIP protein P63165 original sequence version: 125 DIP protein P63165 original sequence version: 83 DIP protein P63165 original sequence version: 85 DIP protein P63165 original sequence version: 81 DIP protein P63165 original sequence version: 84 DIP protein P63165 original sequence version: 103 DIP protein P63165 original sequence version: 100 DIP protein P63165 original sequence version: 95 DIP protein P63165 original sequence version: 98 DIP protein P63165 original sequence version: 101 DIP protein P63165-1 original sequence version: 131 DIP protein P63165 original sequence version: 102 DIP protein P63165 original sequence version: 122 DIP protein P63165 original sequence version: 62 DIP protein P63165 original sequence version: 119 DIP protein P63165 original sequence version: 82 89BE97D2D054FB33 senp1_human Sentrin-specific protease 1 SENP1 Sentrin/SUMO-specific protease SENP1 protein protein human Homo sapiens Human MDDIADRMRMDAGEVTLVNHNSVFKTHLLPQTGFPEDQLSLSDQQILSSRQGHLDRSFTCSTRSAAYNPSYYSDNPSSDSFLGSGDLRTFGQSANGQWRNSTPSSSSSLQKSRNSRSLYLETRKTSSGLSNSFAGKSNHHCHVSAYEKSFPIKPVPSPSWSGSCRRSLLSPKKTQRRHVSTAEETVQEEEREIYRQLLQMVTGKQFTIAKPTTHFPLHLSRCLSSSKNTLKDSLFKNGNSCASQIIGSDTSSSGSASILTNQEQLSHSVYSLSSYTPDVAFGSKDSGTLHHPHHHHSVPHQPDNLAASNTQSEGSDSVILLKVKDSQTPTPSSTFFQAELWIKELTSVYDSRARERLRQIEEQKALALQLQNQRLQEREHSVHDSVELHLRVPLEKEIPVTVVQETQKKGHKLTDSEDEFPEITEEMEKEIKNVFRNGNQDEVLSEAFRLTITRKDIQTLNHLNWLNDEIINFYMNMLMERSKEKGLPSVHAFNTFFFTKLKTAGYQAVKRWTKKVDVFSVDILLVPIHLGVHWCLAVVDFRKKNITYYDSMGGINNEACRILLQYLKQESIDKKRKEFDTNGWQLFSKKSQEIPQQMNGSDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLL DIP protein Q9P0U3 original sequence version: 45 941951A8B341EC64 sumo2_human Small ubiquitin-related modifier 2 SMT3 homolog 2 Sentrin-2 HSMT3 SUMO-3 SUMO2 SMT3H2 SMT3B Ubiquitin-like protein SMT3B protein protein human Homo sapiens Human MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY DIP protein P61956 original sequence version: 39 DIP protein P61956 original sequence version: 79 DIP protein P61956 original sequence version: 81 DIP protein P61956 original sequence version: 77 DIP protein P61956 original sequence version: 98 DIP protein P61956 original sequence version: 116 DIP protein P61956 original sequence version: 141 F8F0426849BEF08B uspl1_human SUMO-specific isopeptidase USPL1 Ubiquitin-specific peptidase-like protein 1 USPL1 C13orf22 D13S106 protein protein human Homo sapiens Human MMDSPKIGNGLPVIGPGTDIGISSLHMVGYLGKNFDSAKVPSDEYCPACREKGKLKALKTYRISFQESIFLCEDLQCIYPLGSKSLNNLISPDLEECHTPHKPQKRKSLESSYKDSLLLANSKKTRNYIAIDGGKVLNSKHNGEVYDETSSNLPDSSGQQNPIRTADSLERNEILEADTVDMATTKDPATVDVSGTGRPSPQNEGCTSKLEMPLESKCTSFPQALCVQWKNAYALCWLDCILSALVHSEELKNTVTGLCSKEESIFWRLLTKYNQANTLLYTSQLSGVKDGDCKKLTSEIFAEIETCLNEVRDEIFISLQPQLRCTLGDMESPVFAFPLLLKLETHIEKLFLYSFSWDFECSQCGHQYQNRHMKSLVTFTNVIPEWHPLNAAHFGPCNNCNSKSQIRKMVLEKVSPIFMLHFVEGLPQNDLQHYAFHFEGCLYQITSVIQYRANNHFITWILDADGSWLECDDLKGPCSERHKKFEVPASEIHIVIWERKISQVTDKEAACLPLKKTNDQHALSNEKPVSLTSCSVGDAASAETASVTHPKDISVAPRTLSQDTAVTHGDHLLSGPKGLVDNILPLTLEETIQKTASVSQLNSEAFLLENKPVAENTGILKTNTLLSQESLMASSVSAPCNEKLIQDQFVDISFPSQVVNTNMQSVQLNTEDTVNTKSVNNTDATGLIQGVKSVEIEKDAQLKQFLTPKTEQLKPERVTSQVSNLKKKETTADSQTTTSKSLQNQSLKENQKKPFVGSWVKGLISRGASFMPLCVSAHNRNTITDLQPSVKGVNNFGGFKTKGINQKASHVSKKARKSASKPPPISKPPAGPPSSNGTAAHPHAHAASEVLEKSGSTSCGAQLNHSSYGNGISSANHEDLVEGQIHKLRLKLRKKLKAEKKKLAALMSSPQSRTVRSENLEQVPQDGSPNDCESIEDLLNELPYPIDIASESACTTVPGVSLYSSQTHEEILAELLSPTPVSTELSENGEGDFRYLGMGDSHIPPPVPSEFNDVSQNTHLRQDHNYCSPTKKNPCEVQPDSLTNNACVRTLNLESPMKTDIFDEFFSSSALNALANDTLDLPHFDEYLFENY FBE4626FC311E706 uspl1_danre SUMO-specific isopeptidase USPL1 uspl1 Ubiquitin-specific peptidase-like protein 1 protein protein danre Danio rerio (Zebrafish) Brachydanio rerio Zebrafish MNGEGTGIGAPTPALAGFLGKSKDRNASPGNCPWCLAKGQTNALRFYAVNLKETVLLCTNAVCLYPLVSRSLEEVRASLSKGGCKRSISSLPDISDDSCPPKRPREEKLDVLADVSEPCDAEVNDATLPDDTVKTQTFTDQQSAPAETISLDKTEEQPVSIEDIKEQPISHDATEGQPISIDQTEEQPVSILHTEEQPIVLDLIEVKPMSVDHSEEQPICIDNTKERPVSIVHTEEQSIVLDLFEVKPMSIAHTEEKPTSFDHIEEKPMSIAHTEEKPVSLVHTEDQHLSIDQTEEQPISIDPTEEQQPEELPAVSDEDVDLCERKEDCVSSTQDEMEEEVLESSSELVPVHSELFWKNEENMCWLDAMLVMLVHCRTIRGTPCRGIKLSDKLATVPCNDSVVWKLCWRYDKTCAYLQARKKQSEDKVLRVPAGVLVEAERRLSALRLSVFKLLQPTLKCEIGQQETPVFALPLLLRSDKWAQDIFQHTIRWEFKCTCCDFTVNESVEKTLTTLTCIVKDWHPLKANNRTQCNKCEHKNQRRKMVLEKLSSVFALHFVEGLPRKDLTKYGFTFQGFQYSVSTIIQYNKHLQHFVTWVRQSNGFWLELDDLKHPYSPTHKRLPFPSSEFHILFWETDSFKEEHSEVCLPTAPPEVPNAPDEHPPKLSDSVATDTCVISALTVEDTTASSIADTSIGSTTLLDTFEGLTHKDIVTLTLVNSESPKNEPRPMRPGFVSAPRHCPFEASNLLSGIPKTGSRLSTPPIPQKSSLVHKPEVAAAAVSKTHLQPTSLFQRHPSFQSTPIRPPPPLPPAPKPKPSLQYDKHEDLPVKPADMFGGFKTKKLANSQPKQISLPGGLNPSVKKTAGQEPISTTEALRLKLMKKLKAKKKKLAKLNQLLGNGGESVAKPDSTALSSPYSVTSSTTTYDSFDDQFLADLLSPATTVSNLSPDSTGLLEMLNNGQNGEQQNPAVATLAPEATLTCSSSTISPLDEYMQSGMCHTALENADFNSLDIFF mint 14BCCCA22B2BC5A6 sumo3_human Small ubiquitin-related modifier 3 SMT3 homolog 1 SUMO-2 SMT3H1 SUMO3 SMT3A Ubiquitin-like protein SMT3A protein protein human Homo sapiens Human MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF DIP protein P55854 original sequence version: 56 DIP protein P55854 original sequence version: 127 DIP protein P55854 original sequence version: 106 DIP protein P55854 original sequence version: 124 DIP protein P55854 original sequence version: 99 E337E34CB5B3B187 senp1-sumo1-1 3 SENP1 9 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined SUMO1 8 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified tandem tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f1b homomint mint sumo1-uspl1 2 SUMO1 8 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined USPL1 11 ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f1c f1d homomint mint sumo2-uspl1-1 2 SUMO3 10 western blot western blot Immuno blot Immuno blot experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined USPL1 11 ms participant Identification by mass spectrometry ms participant experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f1c f1d homomint mint sumo3-uspl1 4 SUMO2 13 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified USPL1 11 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q5W0Q7:p.Trp229Leu mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W L Tue Jul 12 10:50:18 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:16:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp229leu' Tue Jun 30 18:59:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp229Leu' direct interaction direct interaction homomint mint f2a f2b f4c sumo1-uspl1-1 4 SUMO1 8 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified USPL1 11 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q5W0Q7:p.Cys236Ser mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain C S Tue Jul 12 10:08:32 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation increasing' Wed May 02 16:34:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys236ser' Tue Jun 30 19:54:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys236Ser' direct interaction direct interaction f2b homomint mint sumo3-uspl1-1 4 SUMO2 13 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified USPL1 11 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q5W0Q7:p.Trp237Phe mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W F Tue Jul 12 10:24:16 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:43:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp237phe' Tue Jun 30 15:57:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp237Phe' direct interaction direct interaction homomint mint f2a f2b f4c sumo3-uspl1-2 4 USPL1 11 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified Q5W0Q7:p.Glu331Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A Tue Jul 12 10:59:07 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:28:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu331ala' Tue Jun 30 19:46:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu331Ala' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain SUMO2 13 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified direct interaction direct interaction homomint mint f2a f2b f4c sumo3-uspl1-3 4 USPL1 11 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified Q5W0Q7:p.His421Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain H A Tue Jul 12 10:23:49 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:04:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his421ala' Tue Jun 30 16:30:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His421Ala' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain SUMO2 13 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified direct interaction direct interaction homomint mint f2a f2b f4c sumo3-uspl1-4 4 SUMO2 13 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified USPL1 11 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified Q5W0Q7:p.Leu340Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Tue Jul 12 10:23:31 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:24:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu340ala' Tue Jun 30 20:13:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu340Ala' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q5W0Q7:p.Leu341Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Tue Jul 12 10:23:29 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 14:47:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu341ala' Tue Jun 30 18:08:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu341Ala' direct interaction direct interaction homomint mint f2a f2b f4c sumo3-uspl1-5 4 USPL1 11 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp unspecified role unspecified role prey prey purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q5W0Q7:p.Val495Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V A Tue Jul 12 10:51:29 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:37:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val495ala' Tue Jun 30 17:13:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val495Ala' Q5W0Q7:p.Ile494Ala mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I A Tue Jul 12 10:51:31 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 16:37:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile494ala' Tue Jun 30 16:37:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile494Ala' SUMO2 13 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp unspecified role unspecified role bait bait purified purified direct interaction direct interaction homomint mint f2a f2b f4c sumo1-uspl1-2 5 USPL1 11 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp enzyme enzyme neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain SUMO1 8 tag fluorescence tag visualisation by fluorescence tag fluorescence experimental particp experimental participant identification experimental particp enzyme target enzyme target substrate substrate neutral component neutral component purified purified fluorescent prot tag fluorescent prot tag fluorescent protein tag fluorescent prot tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cleavage cleavage reaction cleavage f2c homomint mint sumo3-uspl1-6 5 USPL1 11 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp enzyme enzyme neutral component neutral component purified purified Q5W0Q7:p.Trp229Leu mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W L Tue Jul 12 10:51:18 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:58:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp229leu' Tue Jun 30 19:03:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp229Leu' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain SUMO2 13 tag fluorescence tag visualisation by fluorescence tag fluorescence experimental particp experimental participant identification experimental particp enzyme target enzyme target substrate substrate neutral component neutral component purified purified fluorescent prot tag fluorescent prot tag fluorescent protein tag fluorescent prot tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cleavage cleavage reaction cleavage homomint mint f2c f4b sumo1-uspl1-3 5 SUMO1 8 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp enzyme target enzyme target substrate substrate neutral component neutral component purified purified USPL1 11 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp enzyme enzyme neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cleavage cleavage reaction cleavage f2d homomint mint sumo3-uspl1-7 5 USPL1 11 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp enzyme enzyme neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain SUMO2 13 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp enzyme target enzyme target substrate substrate neutral component neutral component purified purified cleavage cleavage reaction cleavage f2d homomint mint senp1-sumo1-2 5 SENP1 9 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp enzyme enzyme neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain SUMO1 8 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp enzyme target enzyme target substrate substrate neutral component neutral component purified purified cleavage cleavage reaction cleavage f2d homomint mint senp1-sumo3 5 SUMO2 13 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp enzyme target enzyme target substrate substrate neutral component neutral component purified purified SENP1 9 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp enzyme enzyme neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cleavage cleavage reaction cleavage f2d homomint mint sumo1-uspl1-4 5 C13orf22l 12 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp enzyme enzyme neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain SUMO1 8 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp enzyme target enzyme target substrate substrate neutral component neutral component purified purified cleavage cleavage reaction cleavage f3d mint sumo1-uspl1-5 5 SUMO1 8 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp enzyme target enzyme target substrate substrate neutral component neutral component purified purified USPL1 11 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp enzyme enzyme neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cleavage cleavage reaction cleavage f3d homomint mint sumo3-uspl1-8 5 SUMO2 13 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp enzyme target enzyme target substrate substrate neutral component neutral component purified purified USPL1 11 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp enzyme enzyme neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cleavage cleavage reaction cleavage f3d homomint mint sumo2-uspl1-2 5 C13orf22l 12 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp enzyme enzyme neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain SUMO3 10 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp enzyme target enzyme target substrate substrate neutral component neutral component purified purified cleavage cleavage reaction cleavage f3e mint It showed little activity in maturation assays involving human SUMO precursors (Fig 3D), but cleaved SUMO3 chains (Fig 3E) sumo3-uspl1-9 5 SUMO2 13 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp enzyme target enzyme target substrate substrate neutral component neutral component purified purified USPL1 11 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp enzyme enzyme neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q5W0Q7:p.Trp237Phe mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W F Tue Jul 12 10:05:37 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:11:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp237phe' Tue Jun 30 16:19:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp237Phe' cleavage cleavage reaction cleavage homomint mint f2c f4b sumo3-uspl1-10 5 SUMO2 13 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp enzyme target enzyme target substrate substrate neutral component neutral component purified purified USPL1 11 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp enzyme enzyme neutral component neutral component purified purified Q5W0Q7:p.His421Ala mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain H A Tue Jul 12 10:05:10 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:09:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'his421ala' Tue Jun 30 16:38:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.His421Ala' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cleavage cleavage reaction cleavage homomint mint f2c f4b sumo3-uspl1-11 5 SUMO2 13 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp enzyme target enzyme target substrate substrate neutral component neutral component purified purified USPL1 11 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp enzyme enzyme neutral component neutral component purified purified Q5W0Q7:p.Leu340Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Tue Jul 12 10:05:20 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:50:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu340ala' Tue Jun 30 16:15:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu340Ala' Q5W0Q7:p.Leu341Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L A Tue Jul 12 10:23:22 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:57:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu341ala' Tue Jun 30 18:45:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu341Ala' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cleavage cleavage reaction cleavage homomint mint f2c f4b sumo3-uspl1-12 5 USPL1 11 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp enzyme enzyme neutral component neutral component purified purified Q5W0Q7:p.Ile494Val mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain I V Tue Jul 12 10:58:29 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:57:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile494val' Tue Jun 30 16:21:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile494Val' binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q5W0Q7:p.Val495Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V A Tue Jul 12 10:58:26 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:59:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val495ala' Tue Jun 30 19:48:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val495Ala' SUMO2 13 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp enzyme target enzyme target substrate substrate neutral component neutral component purified purified cleavage cleavage reaction cleavage homomint mint f2c f4b sumo3-uspl1-13 5 C13orf22l 12 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp enzyme enzyme neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain SUMO2 13 predetermined predetermined participant predetermined experimental particp experimental participant identification experimental particp enzyme target enzyme target substrate substrate neutral component neutral component purified purified cleavage cleavage reaction cleavage mint sf4b sumo2-uspl1-3 1 C13orf22l 12 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain SUMO3 10 weight by comassie molecular weight estimation by coomasie staining weight by comassie experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component purified purified tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f3c mint coil-uspl1 6 USPL1 11 anti tag immunost anti tag immunostaining anti tag immunost experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Coilin 7 immunostaining immunostaining experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization homomint mint f5c f5h coil-uspl1-1 6 Coilin 7 immunostaining immunostaining experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell USPL1 11 tag fluorescence tag visualisation by fluorescence tag fluorescence experimental particp experimental participant identification experimental particp unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell yfp tag yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization f5c homomint mint