MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it MRPS27 is a pentatricopeptide repeat domain protein required for the translation of mitochondrially encoded proteins. MRPS27 is a pentatricopeptide repeat domain protein required for the translation of mitochondrially encoded proteins. FEBS Lett. (0014-5793) 2012 Davies SM., Lopez Sanchez MI., Narsai R., Shearwood AM., Razif MF., Small ID., Whelan J., Rackham O., Filipovska A. in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Davies SM., Lopez Sanchez MI., Narsai R., Shearwood AM., Razif MF., Small ID., Whelan J., Rackham O., Filipovska A. FEBS Lett. (0014-5793) 2012 rt15_human 28S ribosomal protein S15, mitochondrial MRPS15 RPMS15 DC37 Mitochondrial small ribosomal subunit protein uS15m protein protein human Homo sapiens Human MLRVAWRTLSLIRTRAVTQVLVPGLPGGGSAKFPFNQWGLQPRSLLLQAARGYVVRKPAQSRLDDDPPPSTLLKDYQNVPGIEKVDDVVKRLLSLEMANKKEMLKIKQEQFMKKIVANPEDTRSLEARIIALSVKIRSYEEHLEKHRKDKAHKRYLLMSIDQRKKMLKNLRNTNYDVFEKICWGLGIEYTFPPLYYRRAHRRFVTKKALCIRVFQETQKLKKRRRALKAAAAAQKQAKRRNPDSPAKAIPKTLKDSQ B2D951BC47B8FFEB rt27_human 28S ribosomal protein S27, mitochondrial MRPS27 KIAA0264 Mitochondrial small ribosomal subunit protein mS27 Mitochondrial ribosomal protein S27 protein protein human Homo sapiens Human MAASIVRRGMLLARQVVLPQLSPAGKRYLLSSAYVDSHKWEAREKEHYCLADLASLMDKTFERKLPVSSLTISRLIDNISSREEIDHAEYYLYKFRHSPNCWYLRNWTIHTWIRQCLKYDAQDKALYTLVNKVQYGIFPDNFTFNLLMDSFIKKENYKDALSVVFEVMMQEAFEVPSTQLLSLYVLFHCLAKKTDFSWEEERNFGASLLLPGLKQKNSVGFSSQLYGYALLGKVELQQGLRAVYHNMPLIWKPGYLDRALQVMEKVAASPEDIKLCREALDVLGAVLKALTSADGASEEQSQNDEDNQGSEKLVEQLDIEETEQSKLPQYLERFKALHSKLQALGKIESEGLLSLTTQLVKEKLSTCEAEDIATYEQNLQQWHLDLVQLIQREQQQREQAKQEYQAQKAAKASA DIP protein Q92552 original sequence version: 93 AF8E8D6FC738AA77 mrps15-mrps27 1 MRPS15 2 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level MRPS27 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed tap tagged tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization f2c homomint mint