MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Structural and SAXS analysis of the budding yeast SHU-complex proteins. Structural and SAXS analysis of the budding yeast SHU-complex proteins. FEBS Lett. (0014-5793) 2012 She Z., Gao ZQ., Liu Y., Wang WJ., Liu GF., Shtykova EV., Xu JH., Dong YH. suggested by lperfetto in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined She Z., Gao ZQ., Liu Y., Wang WJ., Liu GF., Shtykova EV., Xu JH., Dong YH. suggested by lperfetto FEBS Lett. (0014-5793) 2012 Structural and SAXS analysis of the budding yeast SHU-complex proteins. Structural and SAXS analysis of the budding yeast SHU-complex proteins. FEBS Lett. (0014-5793) 2012 She Z., Gao ZQ., Liu Y., Wang WJ., Liu GF., Shtykova EV., Xu JH., Dong YH. suggested by lperfetto in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined She Z., Gao ZQ., Liu Y., Wang WJ., Liu GF., Shtykova EV., Xu JH., Dong YH. suggested by lperfetto FEBS Lett. (0014-5793) 2012 shu1_yeast Suppressor of HU sensitivity involved in recombination protein 1 SHU1 YHL006C protein protein yeast Saccharomyces cerevisiae Baker's yeast MQFEERLQQLVESDWSLDQSSPNVLVIVLGDTARKYVELGGLKEHVTTNTVAGHVASRERVSVVFLGRVKYLYMYLTRMQAQANGPQYSNVLVYGLWDLTATQDGPQQLRLLSLVLRQCLSLPSKVEFYPEPPSSSVPARLLRFWDHIIR 8B17700BDAA2367F 8B17700BDAA2367F csm2_yeast Chromosome segregation in meiosis protein 2 YIL132C CSM2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MEYEDLELITIWPSPTKNKLCQFIKQNLSKEHVVTQLFFIDATSSFPLSQFQKLVPPTLPENVRIYENIRINTCLDLEELSAITVKLLQILSMNKINAQRGTEDAVTEPLKIILYINGLEVMFRNSQFKSSPQRSHELLRDTLLKLRVMGNDENENASIRTLLEFPKEQLLDYYLKKNNNTRTSSVRSKRRRIKNGDSLAEYIWKYYADSLFE 55E26899275087AB psy3_yeast Platinum sensitivity protein 3 PSY3 L8039.17 YLR376C protein protein yeast Saccharomyces cerevisiae Baker's yeast MEVLKNIRIYPLSNFITSTKNYINLPNELRNLISEEQESKLGFLHIIESDFKPSVALQKLVNCTTGDEKILIIDIVSIWSQQKQRQHGAIYMNSLSCINITGLIVFLELLYDSPMDALRRCQVDNFNFQLRGIVIDNLSFLNFESDKNYDVINLSKFEKLFKILRKLREFLGCWIITKSFPTDFYNGIENTLVDKWSIKRKSGVTLYPTKLPDSYMKGMDLIIYREVVDGRPQYRRIAALEE B652FD8113EB4C12 B652FD8113EB4C12 shu2_yeast Suppressor of hydroxyurea sensitivity protein 2 D4436 YDR078C SHU2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKDVIEYSKLFAKLVNTNDDTKLDDTIASFLYYMFPRELFIRAISLLESSDMFIYILDRVHNKEGNEHTSLIDVLVDEFYKGSSNSLLEYRLIVKDTNDGAPPILVDIAHWFCSCEEFCKYFHEALEKTDEKEELHDVLINEVDDHLQFSDDRFAQLDPHSLSKQWYFKFDKVCCSHLLAFSILLRSSINVLKFFTVNSNKVFVIAIDNIDEWLNLHINIVE A02B8EBF38FC4423 A02B8EBF38FC4423 csm2-psy3-1 1 CSM2 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified PSY3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction mint f1 t1 Atomic coordinates and structure factors of Psy3-Csm2 were deposited in the Protein Data Bank under the accession number 4EQ6. csm2-psy3-2 2 Shu 1 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Shu 2 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified CSM2 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified PSY3 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified physical association physical association f4 mint