IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Telomeric 3' Overhangs Derive from Resection by Exo1 and Apollo and Fill-In by POT1b-Associated CST. Telomeric 3' Overhangs Derive from Resection by Exo1 and Apollo and Fill-In by POT1b-Associated CST. Cell (0092-8674) 2012 imex curation Wu P., Takai H., de Lange T. Interactions with multiple different baits with the same tag not included as it is difficult to tell what is binding to what. delange@mail.rockefeller.edu 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Wu P., Takai H., de Lange T. Interactions with multiple different baits with the same tag not included as it is difficult to tell what is binding to what. delange@mail.rockefeller.edu Accepted 2012-AUG-14 by JYOTI 19-Sept-2012: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation h7bx60_mouse Protection of telomeres protein 1 Pot1b protein protein mouse Mus musculus Mouse MSSAPVAPSTYTPLNLLKEGTVVNVCGVVKFFKPPYLSKGTDYCSVVTIVDQTNVKLTCMLFSRDYDTLPSVYKVGDIVCFQGLKIQAYKNELQAISKFGFASLTFDGTLGAPIILRTLSKRFNFTAQDYSMVEALRTWASTHISASSNLVQLSDAQPMQYYDLTCQLLGKAQVDGVSFLLKVWDGTRTKIPSWRVCIQDVAFEGDLSHILQLQNLVVDIVVYDNHVQVAKSLKIGSFLRIYSLHTKLQPINSESTTSLVRLEFHLHGGTSYGRGIRVLPESNYDVDQLKKALESVDLEAIQTSDDTYQSDNVENCLTSSSSESDLVSLYEVERCQPLCATTLTGYHHLEKTSLCDILKQRAPRQYRIRAKLRSYKPRRLPQSVKLFCPKCHLLQEIPSEENVDKILQDATATAPDCKLQDTPLYDSEVWTTEGQGGRQVAVHFVKNDGVLPHSSECLVLIEGGRLCEISRLSSMFHSVIPVRSGPEDLELVDLAAPFLIRGKVCHYGCKQCSNLKTIQNLSIIPNKRLWIPSSVAEVLGIVPLQYVFVMTFMFDDGTGVLDVYLKDSEKFFQIPASEVLTDDDLQRNLEQIMNVICPPGIKIDAHPWLECLIKSYNVTSGTEHQICYQIFDTMIAEDII EA07EF724D99831F ctc1_mouse CST complex subunit CTC1 Ctc1 Alpha-accessory factor of 132 kDa Conserved telomere maintenance component 1 protein protein mouse Mus musculus Mouse MAACRAQPPTSEQAWLEAAQTFIQETLCPAGKEVDKELTRSVIACVKETWLSQGENQDLTLPFSYSFVSVQSLKTHQRLPCCSHLSWSQSAYQAWTRGGRPGDGVLPREQLILLGTLVDLLGDSEQECRSGSLYVRDNTGTLDCELIDLDLSWLGHLFLFPSWSYLPSAKRNSLGEGHLELWGTPVPVFPLTVSPGPLIPIPVLYPEKASHLLRYRKKSSIKEINLAGKLVHLSALIITQNKRYFIMTLGELAQAGSQVSIIVQIPAQMVWHRVLRPGRAYVLTKLQVTKTRIHLSCIWTTIPSSTLKPLRPGYVQELELDLEFSKADLKPPPQPTSSKDSRGQEGLVRASKVLHYLGTVTAVLHESAGLYILDGQLILCLAYQKIHGLRRVIRPGVCLELRDVHLLQAVGGATTKPVLALCLHGTVRLQGFSCLKPLTLPSSKVYGASLYEQLVWKCQLGLPLYLWAAKTLEDLIYKLCPHVLRCHQFLKQPSPGKPSLGLQLLAPSWDVLIPPGSPMRHAYSEILEEPHNCPLQKYTPLQTPYSFPTMLALAEEGQHRAWATFDPKAMLPLPEASHLTSCQLNRHLAWSWVCLPSCVFQPAQVLLGVLVASSRKGCLELRDLRGSLPCIPLTESSQPLIDPNLVGCLVRVEKFQLVVEREVRSSFPSWEEMGMARFIQKKQARVYVQFYLADALILPVPRPTFGSEPSQTASSCPEGPHLGQSRLFLLSHKEALMKRNFCLLPGDSSQPAKPTLSFHVSGTWLCGTQRKEGSGWSPPESLAVESKDQKVFLIFLGSSVRWFPFLYPNQVYRLVASGPSQTPVFETEGSAGTSRRPLELADCGSCLTVQEEWTLELGSSQDIPNVLEVPRTLPESSLAQLLGDNSPDSLVSFSAEILSRILCEPPLALRRMKPGNAGAIKTGVKLTVALEMDDCEYPPHLDIYIEDPQLPPQIGLLPGARVHFSQLEKRISRSNIVYCCFRSSTSVQVLSFPPETKASAPLPHIYLAELLQGDRPPFQATTSCHIVYVLSLQILWVCAHCTSICPQGKCSRRDPSCPSQRAVSQANIRLLVEDGTAEATVICRNHLVARALGLSPSEWSSILEHARGPGRVALQFTGLGGQTESASKTHEPLTLLLRTLCTSPFVLRPVKLSFALERRPTDISPREPSRLQQFQCGELPLLTRVNPRLRLVCLSLQEPELPNPPQASAASS 4254E5B091CA5E1D acd_mouse Adrenocortical dysplasia protein Acd protein protein mouse Mus musculus Mouse MSDSGLLALQPWIRELILGSETLSSPRTGQLLKVLQDSETPGPSSAPDTPDTGAVLLVSDGTHSVRCVVTRNAIDTSDWEEKELGFRGTEGRLLLLQACGLRVQVAQDHAPAEFYLQVDRFNLLPTEQPRIQVTGCNQDSDVQRKLNECLEDHLSESASSSAGLTLSQLLDEVREDQDHRGALVCLAKSCLVLKGPCTTTPLTDWITSGSQALGKAVFTVSGSLLHIPEGEEQILSSTGSSQKARGTSASPSHMPLEESGASVSLLSALATSDPGQMDSSQSPPAVGSTSPRAQAPTSPPCNSTPSSLLLNCSPSLSPLHPAPRSHQSCETRAQAPKLEFQCSFKKRQLLPRTSAQELCSVWEPPERHRDTSAFQYKYETPSASLHTQVQTARLSPQLVAWALNIVMESESELTQV 357CB31A8C4639BF stn1_mouse CST complex subunit STN1 Stn1 Alpha-accessory factor of 44 kDa Obfc1 Oligonucleotide/oligosaccharide-binding fold-containing protein 1 Suppressor of cdc thirteen homolog protein protein mouse Mus musculus Mouse MPQPCLLMECESSPREEEIPPLFWGLDPVFLAFAKLYIKDILEMKESQQVPGTYFYNGHPIRRVDIMGAVISVKERETFYSYGVDDATGVINCVCWKKLSNAESSSDPAILSTARELSMTSQLKKLQETIEQKTRIGIGDIIRVRGSVRMFREEREICANIYYKVDDPVWNMQIARMLELPKLYQKVYDQPFRNPALQEEEALNNKDNLDLAGLTSLLSEKIKEFLQEKKMQSFYQQELETVESLQSLASRPVTHSTGSDQVELKDSGTSGVAQRVFKNALQLLQEKGLVFQRDSGSDKLYYVTTKDKDLQQKIYHIIKEDCQKPNHMEKGCHLLHILNCVHLNLRWDLSKAVLQRVLELLEDQSDIVSTADHYYAAF 23C7FC13A10C6F1F ten1l_mouse CST complex subunit TEN1 Ten1 Protein telomeric pathways with STN1 homolog Telomere length regulation protein TEN1 homolog protein protein mouse Mus musculus Mouse MLPKPGVYYFPWEVSDGHVPEGSTLRTFGRLYLYDMARSLMTLAAPQKPDQCQLLVCTNLVEPFEAHVNFLYMVLGDLERMEGGAFVVRARLLTCVEGMDLSLLEKAILEQRRHLQKRQQPIGDASTLQTPTPAPQSIPSDSLSLEPENRGQQVPLPQTLD 4DACAD9187388A33 ctc1-obfc1-1 1 2 unspecified role unspecified role prey prey H7BX60:p.[Leu329Pro;Val332Glu;Asp638_Ile640delinsAsnValVal] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V E certain certain sequence position certain certain certain sequence position certain L P certain certain sequence position certain certain certain sequence position certain DII NVV Thu Jul 07 12:16:13 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was leu329pro_val332glu_asp638asn_ile639-640val Fri Jul 22 11:07:01 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'leu329pro,val332glu,asp638asn,ile639val,ile640val' Wed May 02 19:53:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu329pro,val332glu,asp_ile_ile638-640asn_val_val' Tue Jun 30 20:10:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu329Pro;Val332Glu;Asp638_Ile640delinsAsnValVal]' H7BX60:p.[Leu329Pro;Val332Glu] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L P certain certain sequence position certain certain certain sequence position certain V E Wed May 02 18:31:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu329pro,val332glu' Tue Jun 30 16:22:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu329Pro;Val332Glu]' region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined H7BX60:p.Asp638_Ile640delinsAsnValVal mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain DII NVV Thu Jul 07 12:17:04 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was asp638asn_ile639_640val Fri Jul 22 11:09:45 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'asp638asn,ile639val,ile640val' Wed May 02 15:01:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp_ile_ile638-640asn_val_val' Tue Jun 30 19:10:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp638_Ile640delinsAsnValVal' 5 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 5A, Supp. Fig. 5D I would not normally merge these 2 entires, but because of the author using the same tags on multiple proteins, its the only way I can properly represent reality of the data. pot1b-ctc1 1 5 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 2 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp. Figs. 5A, 5C Flag-tagged Ctc1 and Ten1 also transfected into cells but not shown in complex by western blot pot1b-ctc1-2 1 6 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 2 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp. Fig. 5B Flag-tagged Ctc1 and Ten1 also transfected into cells but not shown in complex by western blot pot1b-ctc1-4 1 2 unspecified role unspecified role bait bait H7BX60:p.[Leu329Pro;Val332Glu;Asp638_Ile640delinsAsnValVal] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V E certain certain sequence position certain certain certain sequence position certain DII NVV certain certain sequence position certain certain certain sequence position certain L P Thu Jul 07 12:16:55 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was leu329pro_val332glu_asp638asn_ile639-640val Fri Jul 22 10:59:18 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'leu329pro,val332glu,asp638asn,ile639val,ile640val' Wed May 02 19:42:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu329pro,val332glu,asp_ile_ile638-640asn_val_val' Tue Jun 30 17:27:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu329Pro;Val332Glu;Asp638_Ile640delinsAsnValVal]' region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined H7BX60:p.Asp638_Ile640delinsAsnValVal mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain DII NVV Thu Jul 07 12:17:03 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was asp638asn_ile639_640val Fri Jul 22 10:53:03 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'asp638asn,ile639val,ile640val' Wed May 02 19:23:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp_ile_ile638-640asn_val_val' Tue Jun 30 20:10:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp638_Ile640delinsAsnValVal' H7BX60:p.[Leu329Pro;Val332Glu] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L P certain certain sequence position certain certain certain sequence position certain V E Wed May 02 18:29:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu329pro,val332glu' Tue Jun 30 18:08:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu329Pro;Val332Glu]' 3 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 5A, Supp. Fig. 6E I would not normally merge these 2 entires, but because of the author using the same tags on multiple proteins, its the only way I can properly represent reality of the data. pot1b-ctc1-5 1 3 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 2 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain H7BX60:p.[Leu329Pro;Val332Glu;Asp638_Ile640delinsAsnValVal] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain DII NVV certain certain sequence position certain certain certain sequence position certain L P certain certain sequence position certain certain certain sequence position certain V E Thu Jul 07 12:17:41 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was leu329pro_val332glu_asp638asn_ile639-640val Fri Jul 22 10:51:29 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'leu329pro,val332glu,asp638asn,ile639val,ile640val' Wed May 02 18:50:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu329pro,val332glu,asp_ile_ile638-640asn_val_val' Tue Jun 30 17:16:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu329Pro;Val332Glu;Asp638_Ile640delinsAsnValVal]' region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined H7BX60:p.Asp638_Ile640delinsAsnValVal mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain DII NVV Thu Jul 07 12:18:34 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was asp638asn_ile639_640val Fri Jul 22 10:54:56 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'asp638asn,ile639val,ile640val' Wed May 02 18:32:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp_ile_ile638-640asn_val_val' Tue Jun 30 19:55:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp638_Ile640delinsAsnValVal' H7BX60:p.[Leu329Pro;Val332Glu] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L P certain certain sequence position certain certain certain sequence position certain V E Wed May 02 17:11:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu329pro,val332glu' Tue Jun 30 19:26:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu329Pro;Val332Glu]' 5 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp. Fig. 5E, 5F, 5H, 5I I would not normally merge these 2 entires, but because of the author using the same tags on multiple proteins, its the only way I can properly represent reality of the data. pot1b-acd-1 1 2 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Fig. 6C I would not normally merge these 2 entires, but because of the author using the same tags on multiple proteins, its the only way I can properly represent reality of the data.