Molecular Connections Molecular Connections Pvt. Ltd. 2/2, Kariappa Road, Basavanagudi, Bangalore -560 004 www.molecularconnections.com Lyn is involved in CD24-induced ERK1/2 activation in colorectal cancer. Lyn is involved in CD24-induced ERK1/2 activation in colorectal cancer. Mol. Cancer 2012 imex curation Su N., Peng L., Xia B., Zhao Y., Xu A., Wang J., Wang X., Jiang B. Cancer - Interactions investigated in the context of cancer The ERK1/2 -Lyn (reverse IP) cannot be added due to lack of antibody specificity. Source of protein CD24 taken from PMID:19860845. sunwingwxy@163.com,helen2003517@163.com 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions human-sw480 Human SW480 adenocarcinoma cell line sw480 SW480- human primary colorectal adenocarcinoma cell line There is a G -> A mutation in codon 273 of the p53 gene resulting in an Arg -> His substitution and a C -> T mutation in codon 309 resulting in a Pro -> Ser substitution. http://www.atcc.org/ATCCAdvancedCatalogSearch/ProductDetails/tabid/452/Default.aspx?ATCCNum=CCL-228&Template=cellBiology anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Su N., Peng L., Xia B., Zhao Y., Xu A., Wang J., Wang X., Jiang B. Cancer - Interactions investigated in the context of cancer The ERK1/2 -Lyn (reverse IP) cannot be added due to lack of antibody specificity. Source of protein CD24 taken from PMID:19860845. sunwingwxy@163.com sunwingwxy@163.com,helen2003517@163.com Accepted 2012-SEP-05 by MGT 11-Oct-2012: Contacted by IntAct-Help. Mol. Cancer 2012 Only protein-protein interactions imex curation Lyn is involved in CD24-induced ERK1/2 activation in colorectal cancer. Lyn is involved in CD24-induced ERK1/2 activation in colorectal cancer. Mol. Cancer 2012 imex curation Su N., Peng L., Xia B., Zhao Y., Xu A., Wang J., Wang X., Jiang B. Cancer - Interactions investigated in the context of cancer The ERK1/2 -Lyn (reverse IP) cannot be added due to lack of antibody specificity. Source of protein CD24 taken from PMID:19860845. sunwingwxy@163.com,helen2003517@163.com 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions human-sw620 Human caucasian colon adenocarcinoma SW620 cells sw620 Human caucasian colon adenocarcinoma SW620 cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Su N., Peng L., Xia B., Zhao Y., Xu A., Wang J., Wang X., Jiang B. Cancer - Interactions investigated in the context of cancer The ERK1/2 -Lyn (reverse IP) cannot be added due to lack of antibody specificity. Source of protein CD24 taken from PMID:19860845. sunwingwxy@163.com sunwingwxy@163.com,helen2003517@163.com Accepted 2012-SEP-05 by MGT 11-Oct-2012: Contacted by IntAct-Help. Mol. Cancer 2012 Only protein-protein interactions imex curation lyn_human Tyrosine-protein kinase Lyn JTK8 Lck/Yes-related novel protein tyrosine kinase V-yes-1 Yamaguchi sarcoma viral related oncogene homolog p53Lyn p56Lyn LYN protein protein human Homo sapiens Human MGCIKSKGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAKLNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDFDPVHGDVIKHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQADGLCRRLEKACISPKPQKPWDKDAWEIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHDKLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIERKNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCFTIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRVENCPDELYDIMKMCWKEKAEERPTFDYLQSVLDDFYTATEGQYQQQP DIP protein P07948 original sequence version: 141 408D3D461204E378 mk01_human Mitogen-activated protein kinase 1 MAPK1 ERK2 PRKM1 Extracellular signal-regulated kinase 2 Mitogen-activated protein kinase 2 MAP kinase isoform p42 ERT1 PRKM2 protein protein human Homo sapiens Human MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS DIP protein P28482 original sequence version: 173 DIP protein P28482 original sequence version: 103 DIP protein P28482 original sequence version: 101 DIP protein P28482 original sequence version: 131 DIP protein P28482 original sequence version: 156 DIP protein P28482 original sequence version: 166 DIP protein P28482 original sequence version: 144 E85D0B2A5D2D724E mk03_human Mitogen-activated protein kinase 3 ERT2 MAP kinase isoform p44 Microtubule-associated protein 2 kinase Extracellular signal-regulated kinase 1 Insulin-stimulated MAP2 kinase p44-ERK1 MAPK3 ERK1 PRKM3 protein protein human Homo sapiens Human MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQPGVLEAP DIP protein P27361 original sequence version: 171 DIP protein P27361 original sequence version: 101 DIP protein P27361 original sequence version: 124 DIP protein P27361 original sequence version: 129 DIP protein P27361 original sequence version: 143 E6020CE413EC41F7 cd24_human Signal transducer CD24 CD24 CD24A Small cell lung carcinoma cluster 4 antigen protein protein human Homo sapiens Human MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS DB1988B6808F833F lyn-mapk1-4 1 6 unspecified role unspecified role ancillary ancillary 3 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role prey prey association association fig. 5a Lyn interacted with ERK1/2 directly or indirectly in a CD24-dependent manner. lyn-mapk1-3 2 5 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role ancillary ancillary association association fig.5b Lyn interacted with ERK1/2 directly or indirectly in a CD24-dependent manner. lyn-cd24-7 2 3 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association fig. 1c lyn-cd24-2 2 6 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association fig. 1c lyn-cd24-4 1 3 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association fig. 1b cd24-lyn 1 3 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association fig. 1b