mpidb The Microbial Protein Interaction Database Essential amino acid residues of BioY reveal that dimers are the functional S unit of the Rhodobacter capsulatus biotin transporter. Essential amino acid residues of BioY reveal that dimers are the functional S unit of the Rhodobacter capsulatus biotin transporter. J. Bacteriol. (0021-9193) 2012 imex curation Kirsch F., Frielingsdorf S., Pohlmann A., Ziomkowska J., Herrmann A., Eitinger T. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli comigration in sds comigration in sds page comigration in sds weight by comassie molecular weight estimation by coomasie staining weight by comassie Kirsch F., Frielingsdorf S., Pohlmann A., Ziomkowska J., Herrmann A., Eitinger T. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation Essential amino acid residues of BioY reveal that dimers are the functional S unit of the Rhodobacter capsulatus biotin transporter. Essential amino acid residues of BioY reveal that dimers are the functional S unit of the Rhodobacter capsulatus biotin transporter. J. Bacteriol. (0021-9193) 2012 imex curation Kirsch F., Frielingsdorf S., Pohlmann A., Ziomkowska J., Herrmann A., Eitinger T. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli comigration in sds comigration in sds page comigration in sds weight by comassie molecular weight estimation by coomasie staining weight by comassie Kirsch F., Frielingsdorf S., Pohlmann A., Ziomkowska J., Herrmann A., Eitinger T. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation Essential amino acid residues of BioY reveal that dimers are the functional S unit of the Rhodobacter capsulatus biotin transporter. Essential amino acid residues of BioY reveal that dimers are the functional S unit of the Rhodobacter capsulatus biotin transporter. J. Bacteriol. (0021-9193) 2012 imex curation Kirsch F., Frielingsdorf S., Pohlmann A., Ziomkowska J., Herrmann A., Eitinger T. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps tag fluorescence tag visualisation by fluorescence tag fluorescence Kirsch F., Frielingsdorf S., Pohlmann A., Ziomkowska J., Herrmann A., Eitinger T. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation q5lr30_ruepo Biotin transporter SPO2302 protein protein ruepo Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) Silicibacter pomeroyi MSMTVLADAIGPREGTARLAKQAVLVVLGIAALAIAAKIKVPMWPVPITMGTFAVLTLGTAYGARLGLVTMMGYLLVGALGFDVFATSSAEKFGLTYMMGGTGGYLVGYLMATVLLGALAARGWDRSFAKMALALVLANVLIYVPGLLWLGQLYGWDKPILQWGLTPFLVGDALKLVLAAVLIPGLWKLVGNARG B78142BA7A2994EB q92ri3_rhime Biotin transporter bioB SMc00964 protein protein sinorhizobium melilo Rhizobium meliloti (strain 1021) (Ensifer meliloti) Sinorhizobium meliloti Ensifer meliloti MNTRDLVLVALFTAIIVVLGLVPPITLGFIPVPITAQSMGVMLAGCIIGAKRGALAFLLLVLLVAIGLPVLSGGRGGLAVLAGPSGGFIFGWAVAAFVTGLIAERFVKPATSEARQFAGFFLASVLGGIVVLYGIGVPWLSAVTGTPLAAAATGSLVFIPGDLLKAAIATLAARAVYAGYPLLPARV DED0161985A701C7 q6n716_rhopa Biotin transporter RPA2447 protein protein rhopa Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) MPLGSSAPPRMGGHTALAAALWPRRTDGFSAWLRMAVLIAFGSVLLALSAKVNLPLPLVPMTLQTLMVVLIGAAYGARLGAATVLAYLAEGAAGLPVFAGPVGGLAPLLGPTAGYLAGFVVAAVLVGWCADRGFDRSVAKLFAAMLAGHLAILTLGFAWLAFGLHLGLAKAWWVGVVPFLAGSLVKSALGAALLPAVRRIVDRQR 8CA1525B2907C3AE q89m96_bradu Biotin transporter blr4297 protein protein braja Bradyrhizobium japonicum (strain USDA 110) MWPTRPGETVGALRAFVLVALGTALLALSAKVNLPLPYVPMTLQTLVVLMIGAAYGWRLGSATMIAYLAEGALGLPVFAGPVGGIAPLVGPTAGYLFGFIAAAFVTGWLAERGWDRSVVLLFAAMAVGHIVILAAGFGWLAFGLGLGASKAWQVGLAPFIAASLVKNALGATLMPAARRIVDRRG 5171B32997347450 a3u2l6_psebh Biotin transporter OB2597_04098 protein protein oceanicola batsensis htcc2597 Oceanicola batsensis HTCC2597 MSQASTARVLTEAFGPTEGAALRLKQAALVVAGIALLAVCAKIKLPVPGSPVAVGMGTFAVLGIGAAYGAKLGLTTIMGYMLIGLLGFDIFQSSTAELNGVDYMMGSTGGYLLGYVLATVLLGALAQRGWDRSVLWMALAMLLGNILLYIPGLGWLGMLYGWDKPILEWGLTPFIIGDLLKLALAALILPAAWKLIGRARG A50CFA75A1075E57 a9cjy4_agrfc Biotin transporter bioY Atu0749 protein protein agrt5 Agrobacterium tumefaciens (strain C58 / ATCC 33970) Agrobacterium tumefaciens (strain C58) MTTRDLVLISLFSAIIIALGLLPPITLGFIPVPITAQSLGVMLAGVVLGAKRGTLAVLLTILIAGIGLPVLSGGRGGLSIFTTPTTGFLIGWIAAVFVTGFLSEKFVHSGQSALAQGVGFFVASLIGGVVVLYAFGITYLALVVGLGFEKAFIGSLLFIPGDALKAVLAALAGRAVMAGYPLLPQRA 762C4D70698232D5 q5ln73_ruepo Biotin transporter SPO3339 protein protein ruepo Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) Silicibacter pomeroyi MKQTTEAVVAGARAPALSGQILRVAAGIAILTLSARVQVPFWPVPMTLQVAAVMALAALYGMRLGTATLAGYLAVGALGLPVFAGTPEKGLGLAYMLGGTGGYLVGFLVASALVGFAADRLHRLALWPAMLLGLAVIYALGLAWLAQFVPADKLLAYGMTPFVAGDLVKVTLAALLVTKLPQGWAERLRGGARHG 709377EC69956E95 bioy_rhocb Biotin transporter BioY bioY Biotin ECF transporter S component BioY RCAP_rcc03249 protein protein rhocb Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) MERNVTLIGLFAALIVALGFVPAIPLGFGVPITLQSLGVMLAGAVLGSWRGALAVLLVQALVAIGLPVLAGGRGGLGIFVGPTAGFLIGWLPAAFVTGLIVERLRRVPVALAAGIGATLGGIIIMYALGILGFWLVKNAGLKPEDAPISLWAATAIMAPFIPGDLVKVVVTGLVARTIAQYRPSALLARG 7C4EABBAE63D0E13 q166h5_rosdo Biotin transporter bioY RD1_2561 protein protein rosdo Roseobacter denitrificans (strain ATCC 33942 / OCh 114) MQMSASHSVLADQFGPAAGTARRIKQAVLVVLGIAVLAVAANIKVPVPGSPVLMNMGTFAVLTIGAAYGARLGLTTIMGYMIIGALGFDIFQSSTAELNGIEYMMGSTGGYLVGYVMATVLLGALAQRGWDRSMVWMAVAMLIGNIVLYVPGLLWLGQLYGWDQPILAWGLTPFLLGDALKLLLAAILLPLVWKLVGDARR D3F87F3F8F6E439E a3tzi7_psebh Biotin transporter OB2597_17167 protein protein oceanicola batsensis htcc2597 Oceanicola batsensis HTCC2597 MTREISIILVGTILLTISAKIVVPFYPVPMSTQTLVVLGLGLFLGPVRSSLVVVTYLFEGLLGLPVFAGTPPAPAGLAYIAGPTGGYLVGFALAAAAAGWVVQALQGLWPSFRASVAVFSGSILMYCAGLFWLGGFVGYGEKLLNAGLYPFLIGDLTKATIAVVLYSAYHNRRAV 73A983A487C7686E bioy-bioy 2 11 unspecified role unspecified role unspecified role unspecified role n-terminal D5ARG8-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal D5ARG8-- flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association figure 3 and 4 bioy-bioy-1 3 11 unspecified role unspecified role unspecified role unspecified role n-terminal D5ARG8-- yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association figure 8 bioy-bioy-2 1 11 unspecified role unspecified role unspecified role unspecified role c-terminal D5ARG8-- flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal D5ARG8-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range direct interaction direct interaction Supp. Fig. 2 q89m96 1 7 unspecified role unspecified role neutral component neutral component region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Supp. Fig. 2 q5ln73 1 10 unspecified role unspecified role neutral component neutral component region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Supp. Fig. 2 a3u2l6 1 8 unspecified role unspecified role neutral component neutral component region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Supp. Fig. 2 q6n716 1 6 unspecified role unspecified role neutral component neutral component region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Supp. Fig. 2 bioy-3 1 9 unspecified role unspecified role neutral component neutral component region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Supp. Fig. 2 bioy-3 1 12 unspecified role unspecified role neutral component neutral component region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Supp. Fig. 2 biob-1 1 5 unspecified role unspecified role neutral component neutral component region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Supp. Fig. 2 q5lr30 1 4 unspecified role unspecified role neutral component neutral component region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Supp. Fig. 2 a3tzi7 1 13 unspecified role unspecified role neutral component neutral component region tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Supp. Fig. 2