mpidb The Microbial Protein Interaction Database Structural characterization of a conserved, calcium-dependent periplasmic protease from Legionella pneumophila. Structural characterization of a conserved, calcium-dependent periplasmic protease from Legionella pneumophila. J. Bacteriol. (0021-9193) 2012 imex curation Chatterjee D., Boyd C.D., O'Toole G.A., Sondermann H. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Chatterjee D., Boyd C.D., O'Toole G.A., Sondermann H. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation Structural characterization of a conserved, calcium-dependent periplasmic protease from Legionella pneumophila. Structural characterization of a conserved, calcium-dependent periplasmic protease from Legionella pneumophila. J. Bacteriol. (0021-9193) 2012 imex curation Chatterjee D., Boyd C.D., O'Toole G.A., Sondermann H. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli pull down pull down predetermined predetermined participant predetermined Chatterjee D., Boyd C.D., O'Toole G.A., Sondermann H. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation q5zxa4_legph lpg0828 protein protein legph Legionella pneumophila subsp. pneumophila MLKESWLLSKSRPRRLSVIAKRFQKVFLESLRYRLVLSIWTGLILCYVTSFSTQAAPLISVEKIQKLAQSYQGDTRKRFTAWGNLIDSLKKKPVKIQLEKVNSFFNQFNYETDPITGASDDYWKSPVEFIVDGGGDCEDFAIIKYFTLVAVGVPSDQLRITYAASLTLNQAHMVLSFYPTPESEPLILDSLESKILKASARPDLKPVYSFNAEGLWLAKTRGESSLMGDSKSLGKWDALMKRME 62CFF7620D583BE8 q3kk32_psepf lapF Pfl01_0130 protein protein psepf Pseudomonas fluorescens MFFAGLTFTIKRFLLCPGCLALAVRFAIPRIARWLACALLLAGIMLGGLHADWDFSAISRKATALYGPLGAGQQRIDAWQNLLATQKQVSEMEKLKVVNLFFNKQMRYVEDIDLWHEVDYWETPIEALWKGAGDCEDYAIAKYFSLRHLGVASDKLRITYVKALRQNRAHMVLTYYSSPDAMPLVLDSLIDPIKPAAERTDLLPVYSFNAEGLYLPGAKGNKKVGDTKRLSRWQDVLKKMQAEGFPVETTN DIP protein Q3KK32 original sequence version: 39 438AE5C5244F9A51 q3kk31_psepf lapD Pfl01_0131 protein protein psepf Pseudomonas fluorescens MSLFKQLLIAICLFLVVAFTGSFMVSLESSRTQYVNQLRSHAQDAATALALSLTPNIDDPAMVELLVSSIFDSGYYSSIRVVDLKTDQTIVERNGIPAVTNVPDWFVKLIGLEPAGGDALVSRGWEQAARVEVVSHPMFALAKLWQSALGSLGWLLVCGAVSAVLGALLLRRQLKPLDYMVKQSHAIARREFLSLPDLPRTPELRRVVLAMNQMVEKLKALFQEQAERSEKLRTESYQDNLTGLANRRYFEMQLNARVSNPEQASSGYLLLLRVKDLAGLNQRLGGQRTDELLKAVGEQLSRECAKYPETQNLVTRIRGGEFAVLAPGMTREEALQLAQSLDSALSSLYATGATDVAAVASIGLAPFAHGDSPQAVLSLGDQALAQAEGQGEQNWACLDQSLVADVGDDHHAWHRLLDQALNQRRFELFFQPVVAAQDTQLVLHYKVLSRLLDEQGQTIPAGRFLPWLERFGWTARLDRLMLERVLEQMAGHEESLALNLSSATLADPQALNKVFEILRAHSNLGARLTLEIGEEQLPEQAVLEQLTRRLRELGFSLSLQRFGGRFSMIGNLARLGLAYLKIDGSYIRAIDQESDKRLFIEAIQRAAHSIDLPLIAERVETEGELSVIREMGLYGVQGQLFGEPKPWG DIP protein Q3KK31 original sequence version: 42 0EC47D6D9BF3C233 q5zxa3_legph lpg0829 protein protein legph Legionella pneumophila subsp. pneumophila MTLTKKMAVGVLIMLLFVFIGTYFITMNNARNFFIQQLESNAQDTATSLGLSLSQSLINHDVPTMDSMVKAVFDRGYFSSIKVQDIKGKVIILKKQLPQESDIPQWFVNLIKWPSTEKSSLIMDGWMQAGVVLVASDPSYVYASLWRNAVEMVNAYLIFALVALVLSYGFLKYLLQPLKRVTAQALAISEHEFPVETKIPKTPELRQVTLAMNQMVTKVKSLFQDQLKQTESLRTQVYQDSLTGMSNRRYFLQHLALILDNEDEFIPGYVMMLVIDGLDELNQKQGYQQGDQLVLTVAKICKSYWKQSSVSTLARINGTTFALISHERDPLVFEKECQEFEQILSQGINDIKICKIHMGAASYFLHQPVSNLLSTVDQAVKKARETGVFYCQKEHDTYKYPQLISGDEIRNSLQQKKISLYAQAVTDGKNCFHKEVFVRIRNQEGEELGAGYFIPVAEKLGLAYPIDQYVLNELTVMDIATHTHFALNISEDTLANKVNSTGYLRQLEDTPAAVLRNLSLEINEAHVLSHFSNSKFFIKQAKKLGVTVGIDRVGIKFSPLHYLSDLNIDYLKLHGSLVTDIDENESKQFFIHYFNEMAKTMDIAVVATQVESEAQWQALQIVHIPWGQGRFLSSVELIK 602477A5DA5312BC lapf-lapd 2 4 unspecified role unspecified role bait bait q3kk32-- Q3KK32-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey Q3KK31:p.Trp125Glu Q3KK31-125-125 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain W E Wed May 02 16:07:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp125glu' Tue Jun 30 18:17:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp125Glu' physical association physical association figure 2 lapf-q5zxa3 2 4 unspecified role unspecified role bait bait q3kk32-- Q3KK32-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey Q5ZXA3:p.Trp126Glu Q5ZXA3-126-126 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain W E Wed May 02 15:19:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp126glu' Tue Jun 30 16:51:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp126Glu' physical association physical association figure 2 q5zxa4-lapd 2 5 unspecified role unspecified role prey prey Q3KK31:p.Trp125Glu Q3KK31-125-125 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain W E Wed May 02 20:26:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp125glu' Tue Jun 30 15:59:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp125Glu' 3 unspecified role unspecified role bait bait q5zxa4-- Q5ZXA4-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association figure 2 q5zxa4-q5zxa3 2 3 unspecified role unspecified role bait bait q5zxa4-- Q5ZXA4-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey Q5ZXA3:p.Trp126Glu Q5ZXA3-126-126 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain W E Wed May 02 18:43:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp126glu' Tue Jun 30 16:12:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp126Glu' physical association physical association figure 2 q5zxa4-1 1 3 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction Fig. 3 1.645 A (4FGQ) Rworking = 0.19 Rfree = 0.22 (4FGQ)