IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Complement c1q activates canonical wnt signaling and promotes aging-related phenotypes. Complement c1q activates canonical wnt signaling and promotes aging-related phenotypes. Cell (0092-8674) 2012 imex curation Naito A.T., Sumida T., Nomura S., Liu M.L., Higo T., Nakagawa A., Okada K., Sakai T., Hashimoto A., Hara Y., Shimizu I., Zhu W., Toko H., Katada A., Akazawa H., Oka T., Lee J.K., Minamino T., Nagai T., Walsh K., Kikuchi A., Matsumoto M., Botto M., Shiojima I., Komuro I. Additional information on constructs obtained from the authors. Details of Fz8 taken from manufacturer's website komuro-tky@umin.ac.jp 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down elisa enzyme linked immunosorbent assay ELISA ELISA elisa Naito A.T., Sumida T., Nomura S., Liu M.L., Higo T., Nakagawa A., Okada K., Sakai T., Hashimoto A., Hara Y., Shimizu I., Zhu W., Toko H., Katada A., Akazawa H., Oka T., Lee J.K., Minamino T., Nagai T., Walsh K., Kikuchi A., Matsumoto M., Botto M., Shiojima I., Komuro I. C1q/Wnt3A was labeled with succinimidyl alkyne (conjugates prepared with the amine-reactive alkyne, succinimidyl ester can be detected with an azide-containing molecule in a click chemistry reaction), and various concentrations of labeled C1q/Wnt3A were mixed with Fz8/Fc . C1q/Wnt3A that bound to Fz8/Fc was coprecipitated with protein G, eluted, and quantified by ELISA using biotin-azide and HRP-streptavidin Unbound C1q/Wnt3A was collected and also quantified by ELISA. Additional information on constructs obtained from the authors. komuro-tky@umin.ac.jp Accepted 2012-AUG-16 by PPORRAS 19-Sept-2012: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation Mock publication and experiment for abstract interactions that are not interaction evidences. Mock publication and experiment for abstract interactions that are not interaction evidences. unspecified method Complement c1q activates canonical wnt signaling and promotes aging-related phenotypes. Complement c1q activates canonical wnt signaling and promotes aging-related phenotypes. Cell (0092-8674) 2012 imex curation Naito A.T., Sumida T., Nomura S., Liu M.L., Higo T., Nakagawa A., Okada K., Sakai T., Hashimoto A., Hara Y., Shimizu I., Zhu W., Toko H., Katada A., Akazawa H., Oka T., Lee J.K., Minamino T., Nagai T., Walsh K., Kikuchi A., Matsumoto M., Botto M., Shiojima I., Komuro I. Additional information on constructs obtained from the authors. Details of Fz8 taken from manufacturer's website komuro-tky@umin.ac.jp 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down sequence tag sequence tag identification sequence tag Naito A.T., Sumida T., Nomura S., Liu M.L., Higo T., Nakagawa A., Okada K., Sakai T., Hashimoto A., Hara Y., Shimizu I., Zhu W., Toko H., Katada A., Akazawa H., Oka T., Lee J.K., Minamino T., Nagai T., Walsh K., Kikuchi A., Matsumoto M., Botto M., Shiojima I., Komuro I. Additional information on constructs obtained from the authors. komuro-tky@umin.ac.jp Accepted 2012-AUG-16 by PPORRAS 19-Sept-2012: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation Complement c1q activates canonical wnt signaling and promotes aging-related phenotypes. Complement c1q activates canonical wnt signaling and promotes aging-related phenotypes. Cell (0092-8674) 2012 imex curation Naito A.T., Sumida T., Nomura S., Liu M.L., Higo T., Nakagawa A., Okada K., Sakai T., Hashimoto A., Hara Y., Shimizu I., Zhu W., Toko H., Katada A., Akazawa H., Oka T., Lee J.K., Minamino T., Nagai T., Walsh K., Kikuchi A., Matsumoto M., Botto M., Shiojima I., Komuro I. Additional information on constructs obtained from the authors. Details of Fz8 taken from manufacturer's website komuro-tky@umin.ac.jp 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Naito A.T., Sumida T., Nomura S., Liu M.L., Higo T., Nakagawa A., Okada K., Sakai T., Hashimoto A., Hara Y., Shimizu I., Zhu W., Toko H., Katada A., Akazawa H., Oka T., Lee J.K., Minamino T., Nagai T., Walsh K., Kikuchi A., Matsumoto M., Botto M., Shiojima I., Komuro I. FZD proteins are mixed with purified C1Q complex from mouse serum but only one of the three proteins are identified as present. Additional information on constructs obtained from the authors. komuro-tky@umin.ac.jp Accepted 2012-AUG-16 by PPORRAS 19-Sept-2012: Contacted by IntAct-Help. Cell (0092-8674) 2012 Only protein-protein interactions imex curation fzd4_human Frizzled-4 FZD4 FzE4 protein protein human Homo sapiens Human MAWRGAGPSVPGAPGGVGLSLGLLLQLLLLLGPARGFGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTAFTVLTFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNLQKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALFRYSADDSNMAVEMLKIFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV E0A83ECEC560A381 fzd7_human Frizzled-7 FzE3 FZD7 protein protein human Homo sapiens Human MRDPGAAAPLSSLGLCALVLALLGALSAGAGAQPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTALPPGASDGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVAHVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV 801934246B426DF5 c1qa_mouse Complement C1q subcomponent subunit A C1qa protein protein mouse Mus musculus Mouse METSQGWLVACVLTMTLVWTVAEDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRTGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSGGQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA 41C2066D49592020 fzd8_human Frizzled-8 FZD8 protein protein human Homo sapiens Human MEWGYLLEVTSLLAALALLQRSSGAAAASAKELACQEITVPLCKGIGYNYTYMPNQFNHDTQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAPLMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSPPRRLPPPPPGEQPPSGSGHGRPPGARPPHRGGGRGGGGGDAAAPPARGGGGGGKARPPGGGAAPCEPGCQCRAPMVSVSSERHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFWIGLWSVLCFVSTFATVSTFLIDMERFKYPERPIIFLSACYLFVSVGYLVRLVAGHEKVACSGGAPGAGGAGGAGGAAAGAGAAGAGAGGPGGRGEYEELGAVEQHVRYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQDGPTKTHKLEKLMIRLGLFTVLYTVPAAVVVACLFYEQHNRPRWEATHNCPCLRDLQPDQARRPDYAVFMLKYFMCLVVGITSGVWVWSGKTLESWRSLCTRCCWASKGAAVGGGAGATAAGGGGGPGGGGGGGPGGGGGPGGGGGSLYSDVSTGLTWRSGTASSVSYPKQMPLSQV E740CBFDA2A233EF c1qc_mouse Complement C1q subcomponent subunit C C1qc C1qg protein protein mouse Mus musculus Mouse MVVGPSCQPPCGLCLLLLFLLALPLRSQASAGCYGIPGMPGMPGAPGKDGHDGLQGPKGEPGIPAVPGTRGPKGQKGEPGMPGHRGKNGPRGTSGLPGDPGPRGPPGEPGVEGRYKQKHQSVFTVTRQTTQYPEANALVRFNSVVTNPQGHYNPSTGKFTCEVPGLYYFVYYTSHTANLCVHLNLNLARVASFCDHMFNSKQVSSGGVLLRLQRGDEVWLSVNDYNGMVGIEGSNSVFSGFLLFPD D3D2EB5851359791 wnt3a_human Protein Wnt-3a WNT3A protein protein human Homo sapiens Human MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYVEIMPSVAEGIKIGIQECQHQFRGRRWNCTTVHDSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGTAAICGCSSRHQGSPGKGWKWGGCSEDIEFGGMVSREFADARENRPDARSAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHTCK DIP protein P56704 original sequence version: 81 DIP protein P56704 original sequence version: 97 DIP protein P56704 original sequence version: 135 A317BD6D4A73920B fzd2_human Frizzled-2 FZD2 FzE2 protein protein human Homo sapiens Human MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQGCEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPALLTTAPPPGLQPGAGGTPGGPGGGGAPPRYATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEETRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVLQERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATIVIACYFYEQAFREHWERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIWSGKTLHSWRKFYTRLTNSRHGETTV AA387876A1DDE063 c1qb_mouse Complement C1q subcomponent subunit B C1qb protein protein mouse Mus musculus Mouse MKTQWGEVWTHLLLLLLGFLHVSWAQSSCTGPPGIPGIPGVPGVPGSDGQPGTPGIKGEKGLPGLAGDLGEFGEKGDPGIPGTPGKVGPKGPVGPKGTPGPSGPRGPKGDSGDYGATQKVAFSALRTINSPLRPNQVIRFEKVITNANENYEPRNGKFTCKVPGLYYFTYHASSRGNLCVNLVRGRDRDSMQKVVTFCDYAQNTFQVTTGGVVLKLEQEEVVHLQATDKNSLLGIEGANSIFTGFLLFPDMDA 0F5C33EA2DE2E253 fzd1_human Frizzled-1 FZD1 FzE1 protein protein human Homo sapiens Human MAEEEAPKKSRAAGGGASWELCAGALSARLAEEGSGDAGGRRRPPVDPRRLARQLLLLLWLLEAPLLLGVRAQAAGQGPGQGPGPGQQPPPPPQQQQSGQQYNGERGISVPDHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPEFWTSNPQHGGGGHRGGFPGGAGASERGKFSCPRALKVPSYLNYHFLGEKDCGAPCEPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYTAVAVAYIAGFLLEDRVVCNDKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFVGLNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQAGGGAPPHPPMSPDFTVFMIKYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNSKQGETTV 7FC916A736482826 fzd8-c1qa 3 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crilo-cho Cricetulus longicaudatus Chinese hamster cho chinese hamster ovary cell line Also called LR73 cells. 7 unspecified role unspecified role prey prey mouse-serum Mouse serum serum Serum physical association physical association Fig. 1E fzd8-c1qa 4 7 unspecified role unspecified role prey prey mouse-serum Mouse serum serum Serum 8 unspecified role unspecified role bait bait c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Fig. 1F fzd8-c1qa-1 4 8 unspecified role unspecified role bait bait region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined extracellar region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 7 unspecified role unspecified role prey prey mouse-serum Mouse serum serum Serum physical association physical association Fig. 1G, Supp. Fig. 1C fzd8-c1q-3 1 33 unspecified role unspecified role prey prey mouse-serum Mouse serum serum Serum 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crilo-cho Cricetulus longicaudatus Chinese hamster cho chinese hamster ovary cell line Also called LR73 cells. physical association physical association Fig. 1H, 1I fzd8-wnt3a-1 1 8 unspecified role unspecified role bait bait c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 10 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 40 42 physical association physical association Supp. Fig. 1D, 1E fzd1-c1qa 4 7 unspecified role unspecified role prey prey mouse-serum Mouse serum serum Serum 13 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined extracellular region sufficient to bind sufficient binding region sufficient to bind range range range range region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp Fig. 1C fzd2-c1qa 4 7 unspecified role unspecified role prey prey mouse-serum Mouse serum serum Serum 11 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined extracellular region sufficient to bind sufficient binding region sufficient to bind range range range range physical association physical association Supp Fig. 1C fzd4-c1qa 4 7 unspecified role unspecified role prey prey mouse-serum Mouse serum serum Serum 5 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region alk phosphatase tag alkaline phosphatase tag alk phosphatase tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined extracellular region sufficient to bind sufficient binding region sufficient to bind range range range range physical association physical association Supp Fig. 1C fzd7-c1qa 4 7 unspecified role unspecified role prey prey mouse-serum Mouse serum serum Serum 6 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind range range range range physical association physical association Supp Fig. 1C fzd8-c1q-5 1 33 competitor competitor competitor prey prey mouse-serum Mouse serum serum Serum 10 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal fc-igg tag fc-igg tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range crigr-cho chinese hamster ovary cell line cho chinese hamster ovary cell line Also called LR73 cells. association association Supp. Fig. 1F c1q_mouse Complement component C1q complex C1q Complement 1q C1QA-C1QB-C1QC complex 6xC1qa:6xC1qb:6xC1qc 12 unspecified role unspecified role cys-29 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-33 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-33 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role cys-29 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-33 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role cys-29 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-33 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-29 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role cys-29 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-32 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role c1ab binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain cys-33 binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role cys-26 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qbc binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role cys-29 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain c1qac binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 82 76 79 83 77 86 80 101 80 86 95 101 122 85 92 89 119 95 91 88 98 94 107 119 122 106 97 103 110 100 104 109 115 112 116 121 113 128 125 118 127 124 physical association physical association mouse Mus musculus Mouse stable complex stable complex biological system reconstruction evidence based on orthology evidence used in manual assertion biological system reconstruction evidence based on orthology evidence used in manual assertion The complex comprises of six heterotrimeric collagen-like triple helices, formed from triplets of the A, B, and C chains, that associate in their N-terminal half to form a stalk, then diverge to form individual stems, each terminating in a C-terminal globular domain Each of the six heterotrimeric globular heads or domains, is made up of the globular domains from one A, one B, and one C chain, each of which in turn has its own ligand specificity. The six collagen-like stalks, which appear to be fibril-like and exist in the central region. The collagen-like region and the globular heads can independently interact with a multiplicity of biological structures including pathogen-associated and cell associated molecules, also each of the individual globular head domains is capable of independently interacting with specific ligands. Chains A and B are disulfide-linked whilst the C chain forms a disulfide bond with the C chain of the next strand. Molecular weight 460 kDa. Recognition unit of the classical pathway of complement which associates with the Ca2+ - dependent C1r(2)-C1s(2) tetramer to form C1 (CPX-4984), the first component of the classical complement system. The complex's role in C1 is the recognition of immune complexes, or other molecules, which trigger the classical pathway of the complement system. Independent of complement activation C1q appears to have additional roles in homeostasis and cellular development, superoxide (O2-) production by neutrophils, blood coagulation and neurological synapse pruning. Heterooctadecamer Accepted 2019-NOV-12 by BMELDAL coronavirus