UniProt UniProt http://www.uniprot.org The clathrin adaptor Dab2 recruits EH domain scaffold proteins to regulate integrin β1 endocytosis. The clathrin adaptor Dab2 recruits EH domain scaffold proteins to regulate integrin β1 endocytosis. Mol. Biol. Cell (1059-1524) 2012 imex curation Teckchandani A., Mulkearns E.E., Randolph T.W., Toida N., Cooper J.A. Origin of used constructs conformed by the author. Colocalization exp using AP-2 antibody (fig S2) omitted as the antibody is unspecific. jcooper@fhcrc.org 15-Nov-2012: Contacted by pporras. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Teckchandani A., Mulkearns E.E., Randolph T.W., Toida N., Cooper J.A. Origin of used constructs conformed by the author. Colocalization exp using AP-2 antibody (fig S2) omitted as the antibody is unspecific. jcooper@fhcrc.org Accepted 2012-OCT-15 by ORCHARD 15-Nov-2012: Contacted by pporras. Mol. Biol. Cell (1059-1524) 2012 Only protein-protein interactions imex curation The clathrin adaptor Dab2 recruits EH domain scaffold proteins to regulate integrin β1 endocytosis. The clathrin adaptor Dab2 recruits EH domain scaffold proteins to regulate integrin β1 endocytosis. Mol. Biol. Cell (1059-1524) 2012 imex curation Teckchandani A., Mulkearns E.E., Randolph T.W., Toida N., Cooper J.A. Origin of used constructs conformed by the author. Colocalization exp using AP-2 antibody (fig S2) omitted as the antibody is unspecific. jcooper@fhcrc.org 15-Nov-2012: Contacted by pporras. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Teckchandani A., Mulkearns E.E., Randolph T.W., Toida N., Cooper J.A. Origin of used constructs conformed by the author. Colocalization exp using AP-2 antibody (fig S2) omitted as the antibody is unspecific. jcooper@fhcrc.org Accepted 2012-OCT-15 by ORCHARD 15-Nov-2012: Contacted by pporras. Mol. Biol. Cell (1059-1524) 2012 Only protein-protein interactions imex curation The clathrin adaptor Dab2 recruits EH domain scaffold proteins to regulate integrin β1 endocytosis. The clathrin adaptor Dab2 recruits EH domain scaffold proteins to regulate integrin β1 endocytosis. Mol. Biol. Cell (1059-1524) 2012 imex curation Teckchandani A., Mulkearns E.E., Randolph T.W., Toida N., Cooper J.A. Origin of used constructs conformed by the author. Colocalization exp using AP-2 antibody (fig S2) omitted as the antibody is unspecific. jcooper@fhcrc.org 15-Nov-2012: Contacted by pporras. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Teckchandani A., Mulkearns E.E., Randolph T.W., Toida N., Cooper J.A. Origin of used constructs conformed by the author. Colocalization exp using AP-2 antibody (fig S2) omitted as the antibody is unspecific. jcooper@fhcrc.org Accepted 2012-OCT-15 by ORCHARD 15-Nov-2012: Contacted by pporras. Mol. Biol. Cell (1059-1524) 2012 Only protein-protein interactions imex curation The clathrin adaptor Dab2 recruits EH domain scaffold proteins to regulate integrin β1 endocytosis. The clathrin adaptor Dab2 recruits EH domain scaffold proteins to regulate integrin β1 endocytosis. Mol. Biol. Cell (1059-1524) 2012 imex curation Teckchandani A., Mulkearns E.E., Randolph T.W., Toida N., Cooper J.A. Origin of used constructs conformed by the author. Colocalization exp using AP-2 antibody (fig S2) omitted as the antibody is unspecific. jcooper@fhcrc.org 15-Nov-2012: Contacted by pporras. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Teckchandani A., Mulkearns E.E., Randolph T.W., Toida N., Cooper J.A. Origin of used constructs conformed by the author. Colocalization exp using AP-2 antibody (fig S2) omitted as the antibody is unspecific. jcooper@fhcrc.org Accepted 2012-OCT-15 by ORCHARD 15-Nov-2012: Contacted by pporras. Mol. Biol. Cell (1059-1524) 2012 Only protein-protein interactions imex curation The clathrin adaptor Dab2 recruits EH domain scaffold proteins to regulate integrin β1 endocytosis. The clathrin adaptor Dab2 recruits EH domain scaffold proteins to regulate integrin β1 endocytosis. Mol. Biol. Cell (1059-1524) 2012 imex curation Teckchandani A., Mulkearns E.E., Randolph T.W., Toida N., Cooper J.A. Origin of used constructs conformed by the author. Colocalization exp using AP-2 antibody (fig S2) omitted as the antibody is unspecific. jcooper@fhcrc.org 15-Nov-2012: Contacted by pporras. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Teckchandani A., Mulkearns E.E., Randolph T.W., Toida N., Cooper J.A. Origin of used constructs conformed by the author. Colocalization exp using AP-2 antibody (fig S2) omitted as the antibody is unspecific. jcooper@fhcrc.org Accepted 2012-OCT-15 by ORCHARD 15-Nov-2012: Contacted by pporras. Mol. Biol. Cell (1059-1524) 2012 Only protein-protein interactions imex curation p98078-1 Disabled homolog 2 Dab2 Doc2 Mitogen-responsive phosphoprotein Adaptor molecule disabled-2 Differentially expressed in ovarian carcinoma 2 protein protein mouse Mus musculus Mouse MSNEVETSTTNGQPDQQAAPKAPSKKEKKKGSEKTDEYLLARFKGDGVKYKAKLIGIDDVPDARGDKMSQDSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNKISFIARDVTDNRAFGYVCGGEGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEDKKKVEEANKAEENGSEALMTLDDQANKLKLGVDQMDLFGDMSTPPDLNSPTESKDILLVDLNSEIDTNQNSLRENPFLTNGVTSCSLPRPKPQASFLPENAFSANLNFFPTPNPDPFRDDPFAQPDQSAPSSFDSLTSPDQKKASLSSSSTPQSKGPLNGDTDYFGQQFDQLSNRTGKPEAQGGPWPYPSSQTQQAVRTQNGVSEREQNGFHIKSSPNPFVGSPPKGLSVPNGVKQDLESSVQSSAHDSIAIIPPPQSTKPGRGRRTAKSSANDLLASDIFASEPPGQMSPTGQPAVPQSNFLDLFKGNAPAPVGPLVGLGTVPVTPPQAGPWTPVVYSPSTTVVPGAIISGQPPSFRQPLVFGTTPAVQVWNQSPSFATPASPPPPTVWCPTTSVAPNAWSSTSPLGNPFQSNNIFPPPTMSTQSSPQPMMSSVLATPPQPPPRNGPLKDIPSDAFTGLDPLGDKEVKEVKEMFKDFQLRQPPLVPSRKGETPPSGTSSAFSSYFNNKVGIPQEHVDHDDFDANQLLNKINEPPKPAPRQGVLLGTKSADNSLENPFSKGFSSSNPSVVSQPASSDPHRSPFGNPFA 856C946BD43C4B07 ep15r_mouse Epidermal growth factor receptor substrate 15-like 1 Eps15-related protein Epidermal growth factor receptor pathway substrate 15-related sequence Eps15l1 Eps15-rs Eps15R protein protein mouse Mus musculus Mouse MAAPLVPLSQQIPGGNPLYESYYKQVDPAYTGRVGASEAALFLKKSGLSDIILGKIWDLADPEGKGFLDKQGFYVALRLVACAQSGHEVTLSSLSLTMPPPKFHDTSSPLMATQSSAETHWAVRVEEKAKFDGIFESLLPVNGLLSGDKVKPVLMNSKLPLDVLGRVWDLSDIDKDGHLDRDEFAVAMHLVYRALEKEPVPSILPPPLIPPSKRKKTVFAGAVPVLPASPPPKDSLRSTPSHGSVSSLNSTGSLSPKHSVKQPPVAWVVPVADKMRFDEIFLKTDLDLDGYVSGQEVKEIFMHSGLTQNLLAHIWALADTRQTGKLSKEQFALAMYFIQQKVSKGIDPPQVLSPDMVPPSERGTPIPDSSSTLASGEFTGVKELDDISQEIAQLQREKYSLEQDIREKEEAIRQKTSEVQELQNDLDRETSSLQELEAQKQDAQDRLDEMDQQKAKLRDMLSDVRQKCQDETQTISSLKTQIQSQESDLKSQEDDLNRAKSELNRLQQEETQLEQSIQAGRAQLETILRSLKCTQDDINQARSKLSQLQESHLEAHRSLEQYDQVPDGVSGTSLPDLATLNEGILLAERGGFGAMDDPFKNKALLFSNNSQELHPDPFQAEDPFKSDPFKGADPFKGDPFQSDPFSEQQTAATDPFGGDPFKESDPFHSSSSDDFFKKQTKNDPFTSDPFTKNPSLPSKLDPFESSDPFSSSSISSKGSDPFGTLDPFGSSSFSSAEGFADFSQMSKPPPSGPFSSSLGGTGFSDDPFKSKQDTPALPPKKPAPPRPKPPSGQSTPVSQLGSSDFPESPDPFQPLGADSGDPFQNKKGFGDPFSGKDPFAPSSSAKPPKTSSSGFADFTSFGNEEQQLAWAKRESEKAEQERLARLRRQEQEDLELAIALSKADMPA B5AF1A89B445E8A7 eps15_human Epidermal growth factor receptor substrate 15 EPS15 AF1P Protein AF-1p protein protein human Homo sapiens Human MAAAAQLSLTQLSSGNPVYEKYYRQVDTGNTGRVLASDAAAFLKKSGLPDLILGKIWDLADTDGKGILNKQEFFVALRLVACAQNGLEVSLSSLNLAVPPPRFHDTSSPLLISGTSAAELPWAVKPEDKAKYDAIFDSLSPVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGMLDRDEFAVAMFLVYCALEKEPVPMSLPPALVPPSKRKTWVVSPAEKAKYDEIFLKTDKDMDGFVSGLEVREIFLKTGLPSTLLAHIWSLCDTKDCGKLSKDQFALAFHLISQKLIKGIDPPHVLTPEMIPPSDRASLQKNIIGSSPVADFSAIKELDTLNNEIVDLQREKNNVEQDLKEKEDTIKQRTSEVQDLQDEVQRENTNLQKLQAQKQQVQELLDELDEQKAQLEEQLKEVRKKCAEEAQLISSLKAELTSQESQISTYEEELAKAREELSRLQQETAELEESVESGKAQLEPLQQHLQDSQQEISSMQMKLMEMKDLENHNSQLNWCSSPHSILVNGATDYCSLSTSSSETANLNEHVEGQSNLESEPIHQESPARSSPELLPSGVTDENEVTTAVTEKVCSELDNNRHSKEEDPFNVDSSSLTGPVADTNLDFFQSDPFVGSDPFKDDPFGKIDPFGGDPFKGSDPFASDCFFRQSTDPFATSSTDPFSAANNSSITSVETLKHNDPFAPGGTVVAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTRPCPLPPGKRSINKLDSPDPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADPSNFANFSAYPSEEDMIEWAKRESEREEEQRLARLNQQEQEDLELAIALSKSEISEA A1B9FE15B47ABAFF p98078-3 Disabled homolog 2 Dab2 Doc2 Mitogen-responsive phosphoprotein Adaptor molecule disabled-2 Differentially expressed in ovarian carcinoma 2 protein protein mouse Mus musculus Mouse MSNEVETSTTNGQPDQQAAPKAPSKKEKKKGSEKTDEYLLARFKGDGVKYKAKLIGIDDVPDARGDKMSQDSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNKISFIARDVTDNRAFGYVCGGEGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEDKKKVEEANKAEENGSEALMTLDDQANKLKLGVDQMDLFGDMSTPPDLNSPTSSANDLLASDIFASEPPGQMSPTGQPAVPQSNFLDLFKGNAPAPVGPLVGLGTVPVTPPQAGPWTPVVYSPSTTVVPGAIISGQPPSFRQPLVFGTTPAVQVWNQSPSFATPASPPPPTVWCPTTSVAPNAWSSTSPLGNPFQSNNIFPPPTMSTQSSPQPMMSSVLATPPQPPPRNGPLKDIPSDAFTGLDPLGDKEVKEVKEMFKDFQLRQPPLVPSRKGETPPSGTSSAFSSYFNNKVGIPQEHVDHDDFDANQLLNKINEPPKPAPRQGVLLGTKSADNSLENPFSKGFSSSNPSVVSQPASSDPHRSPFGNPFA C21F04C80C860424 dab2_mouse Disabled homolog 2 Mitogen-responsive phosphoprotein Dab2 Doc2 Adaptor molecule disabled-2 Differentially expressed in ovarian carcinoma 2 protein protein mouse Mus musculus Mouse MSNEVETSTTNGQPDQQAAPKAPSKKEKKKGSEKTDEYLLARFKGDGVKYKAKLIGIDDVPDARGDKMSQDSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNKISFIARDVTDNRAFGYVCGGEGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEDKKKVEEANKAEENGSEALMTLDDQANKLKLGVDQMDLFGDMSTPPDLNSPTESKDILLVDLNSEIDTNQNSLRENPFLTNGVTSCSLPRPKPQASFLPENAFSANLNFFPTPNPDPFRDDPFAQPDQSAPSSFDSLTSPDQKKASLSSSSTPQSKGPLNGDTDYFGQQFDQLSNRTGKPEAQGGPWPYPSSQTQQAVRTQNGVSEREQNGFHIKSSPNPFVGSPPKGLSVPNGVKQDLESSVQSSAHDSIAIIPPPQSTKPGRGRRTAKSSANDLLASDIFASEPPGQMSPTGQPAVPQSNFLDLFKGNAPAPVGPLVGLGTVPVTPPQAGPWTPVVYSPSTTVVPGAIISGQPPSFRQPLVFGTTPAVQVWNQSPSFATPASPPPPTVWCPTTSVAPNAWSSTSPLGNPFQSNNIFPPPTMSTQSSPQPMMSSVLATPPQPPPRNGPLKDIPSDAFTGLDPLGDKEVKEVKEMFKDFQLRQPPLVPSRKGETPPSGTSSAFSSYFNNKVGIPQEHVDHDDFDANQLLNKINEPPKPAPRQGVLLGTKSADNSLENPFSKGFSSSNPSVVSQPASSDPHRSPFGNPFA DIP protein P98078 original sequence version: 127 856C946BD43C4B07 dab2_human Disabled homolog 2 DAB2 DOC2 Differentially-expressed protein 2 Adaptor molecule disabled-2 Differentially expressed in ovarian carcinoma 2 protein protein human Homo sapiens Human MSNEVETSATNGQPDQQAAPKAPSKKEKKKGPEKTDEYLLARFKGDGVKYKAKLIGIDDVPDARGDKMSQDSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNKISFIARDVTDNRAFGYVCGGEGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEEKKKIEEASKAVENGSEALMILDDQTNKLKSGVDQMDLFGDMSTPPDLNSPTESKDILLVDLNSEIDTNQNSLRENPFLTNGITSCSLPRPTPQASFLPENAFSANLNFFPTPNPDPFRDDPFTQPDQSTPSSFDSLKSPDQKKENSSSSSTPLSNGPLNGDVDYFGQQFDQISNRTGKQEAQAGPWPFSSSQTQPAVRTQNGVSEREQNGFSVKSSPNPFVGSPPKGLSIQNGVKQDLESSVQSSPHDSIAIIPPPQSTKPGRGRRTAKSSANDLLASDIFAPPVSEPSGQASPTGQPTALQPNPLDLFKTSAPAPVGPLVGLGGVTVTLPQAGPWNTASLVFNQSPSMAPGAMMGGQPSGFSQPVIFGTSPAVSGWNQPSPFAASTPPPVPVVWGPSASVAPNAWSTTSPLGNPFQSNIFPAPAVSTQPPSMHSSLLVTPPQPPPRAGPPKDISSDAFTALDPLGDKEIKDVKEMFKDFQLRQPPAVPARKGEQTSSGTLSAFASYFNSKVGIPQENADHDDFDANQLLNKINEPPKPAPRQVSLPVTKSTDNAFENPFFKDSFGSSQASVASSQPVSSEMYRDPFGNPFA 5B2F8B510A580A77 eps15_mouse Epidermal growth factor receptor substrate 15 Protein AF-1p Eps15 protein protein mouse Mus musculus Mouse MAAAAQLSLTQLSSGNPVYEKYYRQVEAGNTGRVLALDAAAFLKKSGLPDLILGKIWDLADTDGKGVLSKQEFFVALRLVACAQNGLEVSLSSLSLAVPPPRFHDSSSPLLTSGPSVAELPWAVKSEDKAKYDAIFDSLSPVDGFLSGDKVKPVLLNSKLPVEILGRVWELSDIDHDGKLDRDEFAVAMFLVYCALEKEPVPMSLPPALVPPSKRKTWVVSPAEKAKYDEIFLKTDKDMDGYVSGLEVRETFLKTGLPSALLAHIWSLCDTKGCGKLSKDQFALAFHLINQKLIKGIDPPHSLTPEMIPPSDRSSLQKNITGSSPVADFSAIKELDTLNNEIVDLQREKNNVEQDLKEKEDTVKQRTSEVQDLQDEVQRESINLQKLQAQKQQVQELLGELDEQKAQLEEQLQEVRKKCAEEAQLISSLKAEITSQESQISSYEEELLKAREELSRLQQETAQLEESVESGKAQLEPLQQHLQESQQEISSMQMRLEMKDLETDNNQSNWSSSPQSVLVNGATDYCSLSTSSSETANFNEHAEGQNNLESEPTHQESSVRSSPEIAPSDVTDESEAVTVAGNEKVTPRFDDDKHSKEEDPFNVESSSLTDAVADTNLDFFQSDPFVGSDPFKDDPFGKIDPFGGDPFKGSDPFASDCFFKQTSTDPFTTSSTDPFSASSNSSNTSVETWKHNDPFAPGGTVVAAASDSATDPFASVFGNESFGDGFADFSTLSKVNNEDAFNPTISSSTSSVTIAKPMLEETASKSEDVPPALPPKVGTPTRPCPPPPGKRPINKLDSSDPLKLNDPFQPFPGNDSPKEKDPDMFCDPFTSSTTTNKEADPSNFANFSAYPSEEDMIEWAKRESEREEEQRLARLNQQEQEDLELAIALSKSEISEA DIP protein P42567 original sequence version: 63 08A0C0D423F873C2 itsn1_mouse Intersectin-1 EH and SH3 domains protein 1 Itsn1 Ese1 Itsn protein protein mouse Mus musculus Mouse MAQFPTPFGGSLDVWAITVEERAKHDQQFLSLKPIAGFITGDQARNFFFQSGLPQPVLAQIWALADMNNDGRMDQVEFSIAMKLIKLKLQGYQLPSTLPPVMKQQPVAISSAPAFGIGGIASMPPLTAVAPVPMGSIPVVGMSPPLVSSVPPAAVPPLANGAPPVIQPLPAFAHPAATLPKSSSFSRSGPGSQLNTKLQKAQSFDVASAPPAAEWAVPQSSRLKYRQLFNSHDKTMSGHLTGPQARTILMQSSLPQAQLASIWNLSDIDQDGKLTAEEFILAMHLIDVAMSGQPLPPVLPPEYIPPSFRRVRSGSGMSVISSSSVDQRLPEEPSSEDEQQPEKKLPVTFEDKKRENFERGSVELEKRRQALLEQQRKEQERLAQLERAEQERKERERQEQERKRQLELEKQLEKQRELERQREEERRKEIERREAAKRELERQRQLEWERNRRQELLNQRNKEQEGTVVLKARRKTLEFELEALNDKKHQLEGKLQDIRCRLATQRQEIESTNKSRELRIAEITHLQQQLQESQQMLGRLIPEKQILSDQLKQVQQNSLHRDSLLTLKRALEAKELARQQLREQLDEVERETRSKLQEIDVFNNQLKELREIHSKQQLQKQRSLEAARLKQKEQERKSLELEKQKEDAQRRVQERDKQWLEHVQQEEQPRPRKPHEEDRLKREDSVRKKEAEERAKPEMQDKQSRLFHPHQEPAKLATQAPWSTTEKGPLTISAQESVKVVYYRALYPFESRSHDEITIQPGDIVMVDESQTGEPGWLGGELKGKTGWFPANYAEKIPENEVPTPAKPVTDLTSAPAPKLALRETPAPLPVTSSEPSTTPNNWADFSSTWPSSSNEKPETDNWDTWAAQPSLTVPSAGQLRQRSAFTPATATGSSPSPVLGQGEKVEGLQAQALYPWRAKKDNHLNFNKSDVITVLEQQDMWWFGEVQGQKGWFPKSYVKLISGPVRKSTSIDTGPTESPASLKRVASPAAKPAIPGEEFIAMYTYESSEQGDLTFQQGDVIVVTKKDGDWWTGTVGDKSGVFPSNYVRLKDSEGSGTAGKTGSLGKKPEIAQVIASYAATGPEQLTLAPGQLILIRKKNPGGWWEGELQARGKKRQIGWFPANYVKLLSPGTSKITPTELPKTAVQPAVCQVIGMYDYTAQNDDELAFSKGQIINVLNKEDPDWWKGEVSGQVGLFPSNYVKLTTDMDPSQQWCSDLHLLDMLTPTERKRQGYIHELIVTEENYVNDLQLVTEIFQKPLTESELLTEKEVAMIFVNWKELIMCNIKLLKALRVRKKMSGEKMPVKMIGDILSAQLPHMQPYIRFCSCQLNGAALIQQKTDEAPDFKEFVKRLAMDPRCKGMPLSSFILKPMQRVTRYPLIIKNILENTPENHPDHSHLKHALEKAEELCSQVNEGVREKENSDRLEWIQAHVQCEGLSEQLVFNSVTNCLGPRKFLHSGKLYKAKSNKELYGFLFNDFLLLTQITKPLGSSGTDKVFSPKSNLQYKMYKTPIFLNEVLVKLPTDPSGDEPIFHISHIDRVYTLRAESINERTAWVQKIKAASELYIETEKKKREKAYLVRSQRATGIGRLMVNVVEGIELKPCRSHGKSNPYCEVTMGSQCHITKTIQDTLNPKWNSNCQFFIRDLEQEVLCITVFERDQFSPDDFLGRTEIRVADIKKDQGSKGPVTKCLLLHEVPTGEIVVRLDLQLFDEP BCF5038160E8208E dab2-eps15-8 4 6 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection P98078-1:p.[Phe589Val;Phe736Val;Phe765Val] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain F V certain certain sequence position certain certain certain sequence position certain F V certain certain sequence position certain certain certain sequence position certain F V Wed May 02 19:38:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe589val,phe736val,phe765val' Tue Jun 30 20:04:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe589Val;Phe736Val;Phe765Val]' region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey physical association physical association 1B dab2-itsn1 3 13 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection P98078-1:p.[Phe589Val;Phe736Val;Phe765Val] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain F V certain certain sequence position certain certain certain sequence position certain F V certain certain sequence position certain certain certain sequence position certain F V Wed May 02 15:54:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe589val,phe736val,phe765val' Tue Jun 30 18:13:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe589Val;Phe736Val;Phe765Val]' region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P98078-1:p.[Phe255Val;Phe398Val] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain F V certain certain sequence position certain certain certain sequence position certain F V Wed May 02 17:33:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe255val,phe398val' Tue Jun 30 16:08:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe255Val;Phe398Val]' P98078-1:p.[Phe255Val;Phe398Val;Phe589Val;Phe736Val;Phe765Val] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain F V certain certain sequence position certain certain certain sequence position certain F V certain certain sequence position certain certain certain sequence position certain F V certain certain sequence position certain certain certain sequence position certain F V certain certain sequence position certain certain certain sequence position certain F V Wed May 02 17:07:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe255val,phe398val,phe589val,phe736val,phe765val' Tue Jun 30 18:25:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe255Val;Phe398Val;Phe589Val;Phe736Val;Phe765Val]' physical association physical association 1C dab2-itsn1-1 3 13 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1C eps15-dab2 1 10 unspecified role unspecified role prey prey purified purified n-terminus t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 1D dab2-eps15-4 1 10 unspecified role unspecified role prey prey purified purified n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction 1D eps15-eps15l1-3 1 10 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 1D eps15l1-dab2 1 10 unspecified role unspecified role prey prey purified purified n-terminal t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction 1D dab2-eps15-6 5 8 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association S1B dab2-eps15-7 2 13 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization S1A dab2-eps15-9 2 8 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization S1A