MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Sumoylation regulates Kap114-mediated nuclear transport. Sumoylation regulates Kap114-mediated nuclear transport. EMBO J. (0261-4189) 2012 imex curation Rothenbusch U., Sawatzki M., Chang Y., Caesar S., Schlenstedt G. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Rothenbusch U., Sawatzki M., Chang Y., Caesar S., Schlenstedt G. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation Sumoylation regulates Kap114-mediated nuclear transport. Sumoylation regulates Kap114-mediated nuclear transport. EMBO J. (0261-4189) 2012 imex curation Rothenbusch U., Sawatzki M., Chang Y., Caesar S., Schlenstedt G. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Rothenbusch U., Sawatzki M., Chang Y., Caesar S., Schlenstedt G. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation siz1_yeast E3 SUMO-protein ligase SIZ1 SIZ1 SAP and Miz-finger domain-containing protein 1 Ubiquitin-like protein ligase 1 E3 SUMO-protein transferase SIZ2 ULL1 YDR409W protein protein yeast Saccharomyces cerevisiae Baker's yeast MINLEDYWEDETPGPDREPTNELRNEVEETITLMELLKVSELKDICRSVSFPVSGRKAVLQDLIRNFLQNALVVGKSDPYRVQAVKFLIERIRKNEPLPVYKDLWNALRKGTPLSAITVRSMEGPPTVQQQSPSVIRQSPTQRRKTSTTSSTSRAPPPTNPDASSSSSSFAVPTIHFKESPFYKIQRLIPELVMNVEVTGGRGMCSAKFKLSKADYNLLSNPNSKHRLYLFSGMINPLGSRGNEPIQFPFPNELRCNNVQIKDNIRGFKSKPGTAKPADLTPHLKPYTQQNNVELIYAFTTKEYKLFGYIVEMITPEQLLEKVLQHPKIIKQATLLYLKKTLREDEEMGLTTTSTIMSLQCPISYTRMKYPSKSINCKHLQCFDALWFLHSQLQIPTWQCPVCQIDIALENLAISEFVDDILQNCQKNVEQVELTSDGKWTAILEDDDDSDSDSNDGSRSPEKGTSVSDHHCSSSHPSEPIIINLDSDDDEPNGNNPHVTNNHDDSNRHSNDNNNNSIKNNDSHNKNNNNNNNNNNNNNDNNNSIENNDSNSNNKHDHGSRSNTPSHNHTKNLMNDNDDDDDDRLMAEITSNHLKSTNTDILTEKGSSAPSRTLDPKSYNIVASETTTPVTNRVIPEYLGNSSSYIGKQLPNILGKTPLNVTAVDNSSHLISPDVSVSSPTPRNTASNASSSALSTPPLIRMSSLDPRGSTVPDKTIRPPINSNSYTASISDSFVQPQESSVFPPREQNMDMSFPSTVNSRFNDPRLNTTRFPDSTLRGATILSNNGLDQRNNSLPTTEAITRNDVGRQNSTPVLPTLPQNVPIRTNSNKSGLPLINNENSVPNPPNTATIPLQKSRLIVNPFIPRRPYSNVLPQKRQLSNTSSTSPIMGTWKTQDYGKKYNSG CBD581DFF23F7802 nse2_yeast E3 SUMO-protein ligase MMS21 MMS21 Methyl methanesulfonate-sensitivity protein 21 Non-structural maintenance of chromosome element 2 E3 SUMO-protein transferase MMS21 NSE2 YEL019C protein protein yeast Saccharomyces cerevisiae Baker's yeast MALNDNPIPKSVPLHPKSGKYFHNLHARDLSNIYQQCYKQIDETINQLVDSTSPSTIGIEEQVADITSTYKLLSTYESESNSFDEHIKDLKKNFKQSSDACPQIDLSTWDKYRTGELTAPKLSELYLNMPTPEPATMVNNTDTLKILKVLPYIWNDPTCVIPDLQNPADEDDLQIEGGKIELTCPITCKPYEAPLISRKCNHVFDRDGIQNYLQGYTTRDCPQAACSQVVSMRDFVRDPIMELRCKIAKMKESQEQDKRSSQAIDVL F200378289B1CEE4 F200378289B1CEE4 imb5_yeast Importin subunit beta-5 KAP114 YGL241W HRC1004 Karyopherin subunit beta-5 Karyopherin-114 114 kDa karyopherin protein protein yeast Saccharomyces cerevisiae Baker's yeast MDINELIIGAQSADKHTREVAETQLLQWCDSDASQVFKALANVALQHEASLESRQFALLSLRKLITMYWSPGFESYRSTSNVEIDVKDFIREVLLKLCLNDNENTKIKNGASYCIVQISAVDFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLATMEIVFKVLNTETSTLIAKIAALKLLKACLLQMSSHNEYDEASRKSFVSQCLATSLQILGQLLTLNFGNVDVISQLKFKSIIYENLVFIKNDFSRKHFSSELQKQFKIMAIQDLENVTHINANVETTESEPLLETVHDCSIYIVEFLTSVCTLQFSVEEMNKIITSLTILCQLSSETREIWTSDFNTFVSKETGLAASYNVRDQANEFFTSLPNPQLSLIFKVVSNDIEHSTCNYSTLESLLYLLQCILLNDDEITGENIDQSLQILIKTLENILVSQEIPELILARAILTIPRVLDKFIDALPDIKPLTSAFLAKSLNLALKSDKELIKSATLIAFTYYCYFAELDSVLGPEVCSETQEKVIRIINQVSSDAEEDTNGALMEVLSQVISYNPKEPHSRKEILQAEFHLVFTISSEDPANVQVVVQSQECLEKLLDNINMDNYKNYIELCLPSFINVLDSNNANNYRYSPLLSLVLEFITVFLKKKPNDGFLPDEINQYLFEPLAKVLAFSTEDETLQLATEAFSYLIFNTDTRAMEPRLMDIMKVLERLLSLEVSDSAAMNVGPLVVAIFTRFSKEIQPLIGRILEAVVVRLIKTQNISTEQNLLSVLCFLTCNDPKQTVDFLSSFQIDNTDALTLVMRKWIEAFEVIRGEKRIKENIVALSNLFFLNDKRLQKVVVNGNLIPYEGDLIITRSMAKKMPDRYVQVPLYTKIIKLFVSELSFQSKQPNPEQLITSDIKQEVVNANKDDDNDDWEDVDDVLDYDKLKEYIDDDVDEEADDDSDDITGLMDVKESVVQLLVRFFKEVASKDVSGFHCIYETLSDSERKVLSEALL 1F4C02AA6AB2FF39 1F4C02AA6AB2FF39 tf2b_yeast Transcription initiation factor IIB SUA7 YPR086W P9513.4 General transcription factor TFIIB Transcription factor E protein protein yeast Saccharomyces cerevisiae Baker's yeast MMTRESIDKRAGRRGPNLNIVLTCPECKVYPPKIVERFSEGDVVCALCGLVLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGETTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCAKEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKTKEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPMQVTTSAEYTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQTLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLDNLPGVEKK 8F1F6D24602436E2 8F1F6D24602436E2 gsp1_yeast GTP-binding nuclear protein GSP1/CNR1 CNR1 CST17 GTPase Ran homolog L8003.19 YLR293C GSP1 Genetic suppressor of PRP20-1 Chromosome stability protein 17 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSAPAANGEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPALAPPEVQVDEQLMQQYQQEMEQATALPLPDEDDADL C9D027033F8C70E1 C9D027033F8C70E1 uba2_yeast Ubiquitin-activating enzyme E1-like UBA2 PIP2 UAL1 YDR390C D9509.10 SMT3-activating enzyme subunit 2 Polymerase-interacting protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPRETSLVTIIGEDSYKKLRSSRCLLVGAGGIGSELLKDIILMEFGEIHIVDLDTIDLSNLNRQFLFRQKDIKQPKSTTAVKAVQHFNNSKLVPYQGNVMDISTFPLHWFEQFDIIFNALDNLAARRYVNKISQFLSLPLIESGTAGFDGYMQPIIPGKTECFECTKKETPKTFPVCTIRSTPSQPIHCIVWAKNFLFNQLFASETSGNEDDNNQDWGTDDAEEIKRIKQETNELYELQKIIISRDASRIPEILNKLFIQDINKLLAIENLWKTRTKPVPLSDSQINTPTKTAQSASNSVGTIQEQISNFINITQKLMDRYPKEQNHIEFDKDDADTLEFVATAANIRSHIFNIPMKSVFDIKQIAGNIIPAIATTNAIVAGASSLISLRVLNLLKYAPTTKYTDLNMAFTAKASNLSQNRYLSNPKLAPPNKNCPVCSKVCRGVIKLSSDCLNKMKLSDFVVLIREKYSYPQDISLLDASNQRLLFDYDFEDLNDRTLSEINLGNGSIILFSDEEGDTMIRKAIELFLDVDDELPCNTCSLPDVEVPLIKANNSPSKNEEEEKNEKGADVVATTNSHGKDGIVILDDDEGEITIDAEPINGSKKRPVDTEISEAPSNKRTKLVNEPTNSDIVELD DBF800E1458B3B10 DBF800E1458B3B10 tbp_yeast TATA-box-binding protein YER148W SPT15 BTF1 TBP1 TATA-box factor TATA-binding factor TATA sequence-binding protein Transcription factor D Transcription initiation factor TFIID TBP subunit protein protein yeast Saccharomyces cerevisiae Baker's yeast MADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAAPESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM 50365FFF1D3718CE 50365FFF1D3718CE rhc31_yeast DNA damage tolerance protein RHC31 AOS1 RHC31 YPR180W P9705.5 RAD31 homolog protein protein yeast Saccharomyces cerevisiae Baker's yeast MDMKVEKLSEDEIALYDRQIRLWGMTAQANMRSAKVLLINLGAIGSEITKSIVLSGIGHLTILDGHMVTEEDLGSQFFIGSEDVGQWKIDATKERIQDLNPRIELNFDKQDLQEKDEEFFQQFDLVVATEMQIDEAIKINTLTRKLNIPLYVAGSNGLFAYVFIDLIEFISEDEKLQSVRPTTVGPISSNRSIIEVTTRKDEEDEKKTYERIKTKNCYRPLNEVLSTATLKEKMTQRQLKRVTSILPLTLSLLQYGLNQKGKAISFEQMKRDAAVWCENLGVPATVVKDDYIQQFIKQKGIEFAPVAAIIGGAVAQDVINILGKRLSPLNNFIVFDGITLDMPLFEF 1ADB7B817BA27F3E 1ADB7B817BA27F3E mms21-kap114 1 KAP114 5 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MMS21 4 weight by comassie molecular weight estimation by coomasie staining weight by comassie predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f6a mint sua7-kap114 1 KAP114 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey partially purified partially purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Sua7 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association homomint mint Purified 6His Kap114 was sumoylated in vitro as described in Figure 1A. Subsequently, the mixture (25% of the load is shown) was incubated at 41C for 1 h with GST Sua7, GST Tbp1, and GST (A) or GST H2A and GST H2B (B) immobilized on glutathione sepharose. After three washing steps, the reactions were further incubated with buffer alone or with excess amounts of 6His Gsp1 Q71L GTP at 41C for 1 h. washing, bound proteins were eluted with SDS sample buffer, separated by SDS PAGE, and detected by western blotting using anti-Kap114 antibodies. f7a f8c sf4 spt15-kap114 1 Tbp1 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined KAP114 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey partially purified partially purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association homomint mint Purified 6His Kap114 was sumoylated in vitro as described in Figure 1A. Subsequently, the mixture (25% of the load is shown) was incubated at 41C for 1 h with GST Sua7, GST Tbp1, and GST (A) or GST H2A and GST H2B (B) immobilized on glutathione sepharose. After three washing steps, the reactions were further incubated with buffer alone or with excess amounts of 6His Gsp1 Q71L GTP at 41C for 1 h. washing, bound proteins were eluted with SDS sample buffer, separated by SDS PAGE, and detected by western blotting using anti-Kap114 antibodies. f7a f8c sf4 gsp1-kap114 1 KAP114 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey partially purified partially purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Gsp1 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association mint The purified 6His-Kap114 and 6His-Kap114 K909R proteins were incubated with the sumoylation factors in the presence or absence of 5 mM ATP as described in Figure 1A. Subsequently, the sumoylation reactions (25 % of the loads are shown) were incubated at 4°C for 1 h with GST-Gsp1 Q71L GTP or with GST immobilized on glutathione sepharose. After three washing steps, the bound proteins were eluted with SDS sample buffer, separated by SDS PAGE, and detected by Western blotting using anti-Kap114 antibodies. sf2 f8c sf4 gsp1-kap114-1 1 KAP114 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey partially purified partially purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Gsp1 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction sf3 mint Purified GST-Mms21 was immobilized on glutathione sepharose (as described in Figure 6) and incubated with buffer alone (lane 1) or with purified 6His-tagged Kap114 (lane 2) at 4°C for 1 h. After three washing steps, bound proteins were eluted by SDS sample buffer (lanes 1 and 2). kap114-mms21 2 KAP114 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined MMS21 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f6b mint kap114-aos1 2 AOS1 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined KAP114 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f6b homomint mint kap114-uba2 2 UBA2 8 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined KAP114 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f6b homomint mint kap114-siz1 2 SIZ1 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined KAP114 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f6b mint kap114-gsp1 2 KAP114 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P53067:p.Lys909Arg mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain K R Tue Jul 12 10:23:26 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation decreasing' Wed May 02 18:30:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys909arg' Tue Jun 30 16:38:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys909Arg' GSP1 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mint f6b f8a